DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btd and SP7

DIOPT Version :9

Sequence 1:NP_511100.1 Gene:btd / 31912 FlyBaseID:FBgn0000233 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001166938.1 Gene:SP7 / 121340 HGNCID:17321 Length:431 Species:Homo sapiens


Alignment Length:437 Identity:134/437 - (30%)
Similarity:173/437 - (39%) Gaps:146/437 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 FLSAAALLSAPPSLSGSSSGSSSGSSPLYGKPPMKLELPYPQASSTGTASPNSSIQSAPSSASVS 156
            |.|...|||.    :||....:||.:..|  ||.....|.|    |||..|...:....||:...
Human    68 FTSTNGLLSP----AGSPPAPTSGYANDY--PPFSHSFPGP----TGTQDPGLLVPKGHSSSDCL 122

  Fly   157 PSIFPS-----PAQSF------ASISASPS---TPTTTLAPPTTAAAG------ALAGS-PTSSS 200
            ||::.|     |..|:      |.||..|.   ||...:.|......|      .|.|: ||..:
Human   123 PSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQGTLPTGPA 187

  Fly   201 -----------PSSSAASAAAAAAA--------------------AAAAAADLGAAAVASAAYGW 234
                       ||..|....|...|                    |...:..|..:..|....|.
Human   188 QPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSGQLEGSGGAKPPRGA 252

  Fly   235 NTAYSGLGPARSQFPYAQYASDYYGNAVGMSSSAAWFSHQERLYQPWSSQSYPGFNFDDIAFQTQ 299
            :|..||               .|.|:..|.||                                 
Human   253 STGGSG---------------GYGGSGAGRSS--------------------------------- 269

  Fly   300 LQRRSVRCTCPNCTNEMSGLPPIVGPDERG-RKQ--HICHIPGCERLYGKASHLKTHLRWHTGER 361
                   |.|||| .|:..|    |....| ||:  |.||||||.::||||||||.|||||||||
Human   270 -------CDCPNC-QELERL----GAAAAGLRKKPIHSCHIPGCGKVYGKASHLKAHLRWHTGER 322

  Fly   362 PFLC--LTCGKRFSRSDELQRHGRTHTNYRPYACPICSKKFSRSDHLSKHKKTHFK-----DKKS 419
            ||:|  |.|||||:|||||:||.||||..:.:.|.:|||:|:||||||||::||.:     ....
Human   323 PFVCNWLFCGKRFTRSDELERHVRTHTREKKFTCLLCSKRFTRSDHLSKHQRTHGEPGPGPPPSG 387

  Fly   420 KKVLA---AEAKEQAAAAIKLEKKEKKSGKPLTPPVEFKQEQPDTTP 463
            .|.|.   :..:|:|:      :..:.|..|.||     ::.|..:|
Human   388 PKELGEGRSTGEEEAS------QTPRPSASPATP-----EKAPGGSP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btdNP_511100.1 C2H2 Zn finger 338..357 CDD:275368 14/18 (78%)
zf-H2C2_2 349..374 CDD:290200 21/26 (81%)
C2H2 Zn finger 365..385 CDD:275368 15/21 (71%)
zf-H2C2_2 377..402 CDD:290200 13/24 (54%)
zf-C2H2 391..413 CDD:278523 13/21 (62%)
C2H2 Zn finger 393..413 CDD:275368 13/19 (68%)
SP7NP_001166938.1 PHA03247 <14..249 CDD:223021 45/190 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..56
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..115 16/53 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..260 20/120 (17%)
9aaTAD. /evidence=ECO:0000269|PubMed:31375868 156..164 2/7 (29%)
C2H2 Zn finger 299..318 CDD:275368 14/18 (78%)
zf-H2C2_2 310..337 CDD:372612 21/26 (81%)
C2H2 Zn finger 326..348 CDD:275368 15/21 (71%)
zf-H2C2_2 340..365 CDD:372612 13/24 (54%)
C2H2 Zn finger 356..376 CDD:275368 13/19 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 367..431 18/68 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.