DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAAR6 and mAChR-C

DIOPT Version :9

Sequence 1:NP_778237.1 Gene:TAAR6 / 319100 HGNCID:20978 Length:345 Species:Homo sapiens
Sequence 2:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster


Alignment Length:308 Identity:80/308 - (25%)
Similarity:134/308 - (43%) Gaps:39/308 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    30 GSRVILYI-VFGFGAVLAVFGNLLVMISILHFKQLHSP-TNFLVASLACADFLVGVTVMPFSMVR 92
            |:..:|:: :..|..||.:.||:|.::::...:.|.|. :|..:.|||.:||.||: .:|:.:| 
  Fly    47 GAGHLLWLAINAFLFVLILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGL-ALPYHLV- 109

Human    93 TVESCWYFGRSFCTFHTCCDVAF------CYSSLFHLCFISIDRYIAVTDPLVYPTKFTVSVSGI 151
                 :|.|.........|.:.|      |..|:..|..|::||||||...|.|....|..|:..
  Fly   110 -----FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYS 169

Human   152 CISVSWILPLMYSGA------VFYTGVYDDGLEELSDAL--NCIGGCQTVVNQNWVLTDFLSFFI 208
            .|..:|.|     ||      ||:....|....|..:.|  ..|.|         |:|.  .|.|
  Fly   170 IIIFNWCL-----GALVALLPVFWNRWPDAQACEFDEVLAPGYIAG---------VITP--GFVI 218

Human   209 PTFIMIILYGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVAFMISWLP 273
            ....|.::|..|...|.:||.::..:.......:.:.:..:...:.|:.:.:...:..|.:.|||
  Fly   219 IWICMFLVYWRIMREASKQALRLRQSVVYNTDEATTMRNLLLHPDWKSVQIVVFIMGCFTLCWLP 283

Human   274 YSIDSLIDAFMGFITPACIYEICCWCAYYNSAMNPLIYALFYPWFRKA 321
            |...::...|....:.:.||:.....|..|||:||:||:.....||:|
  Fly   284 YFCVAIAQLFSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRA 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAAR6NP_778237.1 7tm_4 43..>271 CDD:304433 59/242 (24%)
7tm_1 49..311 CDD:278431 70/276 (25%)
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 77/294 (26%)
7tm_1 67..321 CDD:278431 70/276 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.