DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAAR6 and hrh4.b2

DIOPT Version :9

Sequence 1:NP_778237.1 Gene:TAAR6 / 319100 HGNCID:20978 Length:345 Species:Homo sapiens
Sequence 2:XP_031760447.1 Gene:hrh4.b2 / 100485915 XenbaseID:XB-GENE-22168371 Length:390 Species:Xenopus tropicalis


Alignment Length:380 Identity:94/380 - (24%)
Similarity:164/380 - (43%) Gaps:84/380 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    27 FSPGSRVILYIVFGFGAVLAVFGNLLVMISILHFKQLHSPTNFLVASLACADFLVGVTVMPFSMV 91
            ||....:::..:.....:|.|.||.||:::....|:|.:.:||.:.:|:.|||::|...:|..:.
 Frog    25 FSDAVNILIIALISLLILLTVGGNTLVILAFFVEKRLRNQSNFFLLNLSIADFILGTFAIPLYVP 89

Human    92 RTVESCWYFGRSFCTFHTCCDVAFCYSSLFHLCFISIDRYIAVTDPLVY------PTKFTVSVSG 150
            ..:...|..|:..|......|...|.:|.|::..||.||:::||..::|      |.:..:.::.
 Frog    90 YLLTGKWLLGKFLCKLWLIVDYTMCTASAFNVALISWDRFLSVTQAVLYRSQQNRPCRTVIKMAA 154

Human   151 ICISVSWILP-LMYSGAVFYTGVYDDGLEELSDALNCIGGCQTVVNQNW--VLT-DFLSFFIP-- 209
            :     |||. |:|..|:.:.. :....||:.:.: |:.|    ....|  :|| ....|.:|  
 Frog   155 V-----WILSFLLYGPAIIFWD-FVPSTEEIPENI-CVAG----FYYTWYYLLTASAFDFVLPLI 208

Human   210 --TFIMIILYGNIFLVARRQAKKIENTGS------------------------KTESSSESYKAR 248
              :|..:.:|.||   .:|..:|::|:.|                        :.:...:|::.|
 Frog   209 SISFFNLSIYCNI---KKRSRRKMQNSISLPPQKSRKEAKLCTIATNITLQSPQIDIQKKSFRRR 270

Human   249 V-----------------------------ARRERKAAKTLGVTVVAFMISWLPYS-IDSLIDAF 283
            :                             ..|::|.||:|.|.|..|.|.|.||| :.|:..|.
 Frog   271 INISCNQCFGIKSSSHNNKRSDRENNQVSDLSRDKKVAKSLSVLVCIFAICWAPYSFLMSIRAAC 335

Human   284 MGFITPACIYEICCWCAYYNSAMNPLIYALFYPWFRKAIKVIVTGQVLK--NSSA 336
            .|:......|:|..|..:.|||:||:||.|.:..|:||...||....:|  |.||
 Frog   336 HGYCIHIYWYDITFWLLWTNSAINPIIYPLCHKGFQKAFLNIVKYVCMKKTNDSA 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAAR6NP_778237.1 7tm_4 43..>271 CDD:304433 65/294 (22%)
7tm_1 49..311 CDD:278431 78/329 (24%)
hrh4.b2XP_031760447.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.