DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAAR6 and drd1c

DIOPT Version :9

Sequence 1:NP_778237.1 Gene:TAAR6 / 319100 HGNCID:20978 Length:345 Species:Homo sapiens
Sequence 2:XP_004915948.1 Gene:drd1c / 100124855 XenbaseID:XB-GENE-5919679 Length:465 Species:Xenopus tropicalis


Alignment Length:353 Identity:105/353 - (29%)
Similarity:169/353 - (47%) Gaps:38/353 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSSNSSLLVAVQLCYA--NVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHFKQL 63
            |.:.|...|.|.:.:|  :|..|.:.:      |.:..::.....:..:.||.||.::::.|:.|
 Frog     1 MENLSIYNVTVNVLHADLDVGSSDLSL------RALTGLLLSLLILSTLLGNTLVCLAVIKFRHL 59

Human    64 HSP-TNFLVASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSLFHLCFIS 127
            .|. |||.|.|||.:|..|.:.|||:..|..|...|.|| .||......|:....:|:.:||.||
 Frog    60 RSKVTNFFVISLAVSDLFVALLVMPWKAVTEVAGYWLFG-DFCDTWVAFDIMCSTASILNLCIIS 123

Human   128 IDRYIAVTDPLVYPTKFTVSVSGICISVSWILPLMYSGAVFYTGVYDDGLEELSDALNCIG---G 189
            :|||.|:..|..|..|.|..|:.|.|.|:|.|.::.|........:..  :|:.:.||.|.   .
 Frog   124 LDRYWAIASPFRYERKMTQRVAFIMIGVAWTLSILISFIPVQLSWHKS--QEVDEELNAINHTEN 186

Human   190 CQTVVNQNWVL-TDFLSFFIPTFIMIILYGNIFLVARRQAKKIEN---------TGSKTESSSES 244
            |.:.:|:.:.: :..:||:||..|||..|..|:.:|:.|.::|.:         :|....|:..|
 Frog   187 CDSSLNRTYAISSSLISFYIPVVIMIGTYTRIYRIAQTQIRRISSLERAVEHAQSGHPDCSNENS 251

Human   245 YKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLIDAFMGFITPA-------CI----YEICCW 298
            .|... |:|.|..|||.:.:..|:..|||:.:.:.:..|.....|.       |:    :.|..|
 Frog   252 LKTSF-RKETKVLKTLSIIMGVFVFCWLPFFVLNCMIPFCHMSLPGQNEPEPPCVSETTFNIFVW 315

Human   299 CAYYNSAMNPLIYALFYPWFRKAIKVIV 326
            ..:.||::||:||| |...||||...|:
 Frog   316 FGWANSSLNPVIYA-FNADFRKAFTTIL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAAR6NP_778237.1 7tm_4 43..>271 CDD:304433 76/241 (32%)
7tm_1 49..311 CDD:278431 88/286 (31%)
drd1cXP_004915948.1 7tmA_D1-like_dopamine_R 46..338 CDD:320185 94/296 (32%)
TM helix 2 64..91 CDD:320185 13/26 (50%)
TM helix 3 101..131 CDD:320185 11/29 (38%)
TM helix 4 143..163 CDD:320185 7/19 (37%)
TM helix 5 192..222 CDD:320185 10/29 (34%)
TM helix 6 257..287 CDD:320185 10/29 (34%)
TM helix 7 307..332 CDD:320185 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.