DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3106 and Ptpn9

DIOPT Version :9

Sequence 1:NP_001285060.1 Gene:CG3106 / 31909 FlyBaseID:FBgn0030148 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_062625.2 Gene:Ptpn9 / 56294 MGIID:1928376 Length:593 Species:Mus musculus


Alignment Length:280 Identity:56/280 - (20%)
Similarity:93/280 - (33%) Gaps:106/280 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 PEVFELGICVPKTCSAAK--TEKLLKYAITHFYGQDVMESNYTMVTEARCKYDAPIELRGIDIFA 230
            ||:      .|:...|.|  .|::.|:.:.  |....:..|..:......|:|.   ||.:::| 
Mouse    13 PEL------TPEEEQATKQFLEEINKWTVQ--YNVSPLSWNVAVKFLMARKFDV---LRAVELF- 65

  Fly   231 IIFFSLIIFFMVASSVYDYIQTRK--GAPK-----KPLLIAFSVLTNAPKIFTVKKVNNPNVIHC 288
                            :.|.:||:  |..|     :||  ...:|:..   ||:..|.:|.    
Mouse    66 ----------------HCYRETRRKEGIVKLKPHEEPL--RSEILSGK---FTILNVRDPT---- 105

  Fly   289 LNGLRCFSMMWVVFGHGYMTF-YDLPHINKNKFYTWVQTPYSMLVQNGSLCVDTFFFM-SGLL-- 349
                          |.....| ..|.|.:|:..:..:|..:.:|    ...||:|... :||:  
Mouse   106 --------------GASIALFTARLHHPHKSAQHVVLQALFYLL----DRAVDSFETQRNGLVFI 152

  Fly   350 --MCWGAFREMERTKGKLNIPMMYFHRYIRLTPVVAVVVLYIMSLYKYSGAGPMWFKLGTQDKRC 412
              ||...:...|...||..:.::......||..|:.|            || |:||::       
Mouse   153 YDMCGSNYANFELDLGKKVLNLLKGAFPARLKKVLIV------------GA-PIWFRV------- 197

  Fly   413 ADTWWATLIYVQNYAFPYSI 432
                            ||||
Mouse   198 ----------------PYSI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3106NP_001285060.1 NRF 91..217 CDD:214781 9/50 (18%)
Acyl_transf_3 286..635 CDD:280013 30/153 (20%)
OafA 289..702 CDD:224748 30/150 (20%)
Ptpn9NP_062625.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 3/12 (25%)
CRAL_TRIO_N 20..66 CDD:215024 11/67 (16%)
SEC14 90..240 CDD:214706 35/173 (20%)
PTPc 302..573 CDD:214550
PTPc 329..573 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.