DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3106 and CG30467

DIOPT Version :9

Sequence 1:NP_001285060.1 Gene:CG3106 / 31909 FlyBaseID:FBgn0030148 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_611044.1 Gene:CG30467 / 36719 FlyBaseID:FBgn0050467 Length:521 Species:Drosophila melanogaster


Alignment Length:132 Identity:26/132 - (19%)
Similarity:51/132 - (38%) Gaps:30/132 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 VFELGICVPKTCSAAKTEKLLKYAITHFYGQDVMESNYTMVTEARCKYDAPIELRGIDIFAIIFF 234
            :|::..|: .|....:..:|.:|.:.|.                         |.|.:.||:.::
  Fly   174 LFKMTYCM-DTAMLIQLMRLFQYIMAHV-------------------------LSGKEKFAVNWY 212

  Fly   235 SLIIFFMVASSVYDYIQTRKGAPKKPLLIAFSVLTNAPKIFTVKKVNNPNVIHCLNGLRCFSMMW 299
              |.|....:|..:..:..:.:....||:|....||| .:.:...|...|....|| |:.|:.::
  Fly   213 --ICFAAFENSAQNLGRILQLSVSDELLVAALKATNA-VLASCALVEEENANSTLN-LKPFAEVF 273

  Fly   300 VV 301
            :|
  Fly   274 LV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3106NP_001285060.1 NRF 91..217 CDD:214781 6/46 (13%)
Acyl_transf_3 286..635 CDD:280013 5/16 (31%)
OafA 289..702 CDD:224748 5/13 (38%)
CG30467NP_611044.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3700
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.