DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3106 and oac-24

DIOPT Version :9

Sequence 1:NP_001285060.1 Gene:CG3106 / 31909 FlyBaseID:FBgn0030148 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_504267.3 Gene:oac-24 / 185503 WormBaseID:WBGene00018211 Length:650 Species:Caenorhabditis elegans


Alignment Length:219 Identity:56/219 - (25%)
Similarity:82/219 - (37%) Gaps:59/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 IHCLNGLRCFSMMWVVFGHGYMTFYDLPHINKNKFYTWVQTPYSMLVQNGSLCVDTFFFMSGLLM 350
            |.||.|:   :::.|...|.:.|                      |..||.|.||.||.:||.||
 Worm     5 IQCLRGI---AIVCVFIYHLFPT----------------------LFVNGFLGVDVFFVISGYLM 44

  Fly   351 CWGAFREMERTKGKL----NIPMMYFHRYIRLTPVVAVVVLYIMSLYKYSGAGPMWFKLGTQDKR 411
            .      ...||.||    :....|:.|:.|:.||..:|:|..:.|.:......:|   |..|: 
 Worm    45 A------KNLTKTKLSKVSDFISFYYRRFKRILPVYYLVILVTVILLRIYYEDFLW---GNNDR- 99

  Fly   412 CADTWWATLIYVQNYAFPY--------------SICI-SQSWYLAVDTQLYFLSPLFLIPLWKWG 461
               ...|:|..|.|....:              |:.| ...|.|:|:.|.|.|.|.....|..: 
 Worm   100 ---YGLASLCLVTNQLIIHDQADYFREFQAERSSLNIFVHLWSLSVEMQFYLLVPFIFFGLQHY- 160

  Fly   462 KKALVPIVIVLILCLGGTFATFML 485
            ||....::.|.|:.:.| |..|.|
 Worm   161 KKETCKLMTVSIISIFG-FVGFAL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3106NP_001285060.1 NRF 91..217 CDD:214781
Acyl_transf_3 286..635 CDD:280013 56/219 (26%)
OafA 289..702 CDD:224748 54/216 (25%)
oac-24NP_504267.3 OafA 1..343 CDD:224748 56/219 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.