DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3106 and oac-13

DIOPT Version :9

Sequence 1:NP_001285060.1 Gene:CG3106 / 31909 FlyBaseID:FBgn0030148 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_493150.2 Gene:oac-13 / 184022 WormBaseID:WBGene00008475 Length:659 Species:Caenorhabditis elegans


Alignment Length:465 Identity:103/465 - (22%)
Similarity:164/465 - (35%) Gaps:155/465 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 LNGLRCFSMMWVVFGHGYMTFYDLPHINKNKFYTWVQTPYSMLVQNGSLCVDTFFFMSGLLMCWG 353
            |.|||.|:::.|:..|.|      |.|                |.||.|.||.||.:||.|||. 
 Worm    10 LQGLRGFAIVAVLGFHFY------PEI----------------VPNGYLGVDQFFVLSGFLMCM- 51

  Fly   354 AFREMERTKGKLNIPMMYFHRYIRLTPV-VAVVVLYIMSLY-----------KYSGAGPMWFKLG 406
            ..:.:|.......|.:.|..|:.|:.|: :..::|.::|||           |.|..|.:.|...
 Worm    52 LLKRVETQPTCTLITLFYSKRFKRILPLYLFTILLSMISLYSVFPDTIAEFNKNSALGALLFVSN 116

  Fly   407 TQDKRCADTWWATLIYVQNYAFPYSICISQSWYLAVDTQLYFLSPLFLIPLWKWGKKALVPIVIV 471
            |. |...|.::..|....:       ..:.:|.|:|:.|.|||.|:..:...:..:|..|...||
 Worm   117 TA-KSKEDDYFVQLTKAMD-------IFTHTWSLSVEVQFYFLVPVVFLVALRLPEKLQVGFYIV 173

  Fly   472 LILCLGGTFATFMLN-DFTLFRVQDDQVDLRQRLTYYPTHTRIPTWLIGVI-------------- 521
            |.:|   ::|.|.:: ||..|.               ....||..:|:|:|              
 Worm   174 LGIC---SYAFFYISQDFIAFN---------------NVFARIWQFLVGMIVYTIGLPNPQYQVI 220

  Fly   522 -----------------------FGYF----LFTRNRGRQIPMS------KPLVL--TGWFVAFG 551
                                   :.||    |||   ....|:.      :|||.  ||.|:.  
 Worm   221 NQDIEECENLIDSEEVPETPCNMYSYFLLLGLFT---VAAFPLKLHPLIVRPLVTVGTGSFIL-- 280

  Fly   552 TMLACMWGPYWRILPDTPDSPLIEGAFFEPLSRTSWALSIGWIVWACYNGHGGLVNDFLSWGFFT 616
                                 :.||.|.......|:   ||.|.:|.|         .|.|..::
 Worm   281 ---------------------ISEGNFLVSNKLISY---IGDISYALY---------LLHWPIYS 312

  Fly   617 GFSRLCYCMYVIHRIVQLVNAARLQTDTHFSNYDAILRWWHDFGITLTASIFATLAFEAPILGIE 681
             :.:|.:..|....|..|:::..|....|    :...:|:.:...| :..:...|.|.:.::.||
 Worm   313 -YWKLNWVQYDQLLIFVLLSSIILAVIVH----ETFEKWYLNLSST-SVGLLVVLLFASNVILIE 371

  Fly   682 KAIFGKPAPK 691
            |..|..|..:
 Worm   372 KDKFLPPVDR 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3106NP_001285060.1 NRF 91..217 CDD:214781
Acyl_transf_3 286..635 CDD:280013 91/407 (22%)
OafA 289..702 CDD:224748 103/465 (22%)
oac-13NP_493150.2 OafA 5..350 CDD:224748 95/431 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.