DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3106 and rhy-1

DIOPT Version :9

Sequence 1:NP_001285060.1 Gene:CG3106 / 31909 FlyBaseID:FBgn0030148 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_495954.1 Gene:rhy-1 / 174455 WormBaseID:WBGene00012324 Length:502 Species:Caenorhabditis elegans


Alignment Length:505 Identity:112/505 - (22%)
Similarity:188/505 - (37%) Gaps:144/505 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 SVLTNAPKIFTVKKVNNP----------------NVIHC--------------------LNGLRC 294
            |.||||....||:..::|                :|..|                    |:..|.
 Worm    36 SCLTNAFIPDTVRMASSPLLAWMTLVVIGTLAPVSVFSCLSLKRSVKELLTERSSKLDVLDIFRF 100

  Fly   295 FSMMWVVFGH----GYMTFYD-LPHINKNKFYTWVQTPYSMLVQNGSLCVDTFFFMSGLLMCWGA 354
            .:::||:..|    |.:...| ||..:..|........:..|:.|.:|.|:.|..:||||.....
 Worm   101 VAILWVMLNHTGSEGRIDILDRLPSADAFKSAMHDHPIFGALMGNSALGVEIFLVLSGLLAARSW 165

  Fly   355 FREMERTKGKLNIPMMYF--------HRYIRLTPVVAVVVLYIMSLYKYSGAGPMWFKL-----G 406
            .|:.:..         :|        .|.:||.|        .|.::.|..|||:...|     .
 Worm   166 LRKADEP---------FFQHWKSFIARRLLRLAP--------SMFIFVYIAAGPIMNALLPRYSS 213

  Fly   407 TQDKRCADTWWATLIYV---QNY-AFPYSICISQSWYLAVDTQLYFLSPLFLIPLWKWGKKAL-- 465
            :....|.  :|..|.:|   .|: :.|  .|:...|||.:|.|||.::|:||..|.|:.|:.:  
 Worm   214 SMVSACG--FWGILSHVTFTSNWQSTP--TCMGYLWYLGLDMQLYMVAPIFLNLLHKFPKRGMAL 274

  Fly   466 -VPIVIVLILCLGG---TFATFMLND----FTLFRVQDDQV---------DLRQRLTYYPTHTRI 513
             :..:|..::...|   .:.|...:|    |..:..||.:.         |:     |...:|:.
 Worm   275 TITTIIASMVIRAGYCTAYGTCNQSDVDIPFISYPGQDAETLKSIYAGLWDM-----YSRPYTKC 334

  Fly   514 PTWLIGVIFGYFLFTRNRGRQIPMSKPLVLTGWFVAFGTMLACMWGPYWRILPDTPDSPLIEGAF 578
            ..:|||::.||...:.........||.|..:...||..|:.|.: ..||.  |:..::  :....
 Worm   335 GPFLIGLLLGYITVSSKYIMVSTTSKTLFRSSLIVAIATIYAIL-PEYWN--PNAGNT--LYNTV 394

  Fly   579 FEPLSRTSWALSIGWIVWACY--------NGHGGLVNDFLSWGFFTGFSRLCYCMYVIHR-IVQL 634
            :..:.|:.:|::|..::.|.|        |            ..|...::|.|..|::|. :|.:
 Worm   395 YTAVFRSVFAMAISGMIAALYFRQEYRPTN------------PIFAMLAKLTYNAYLLHMPVVYI 447

  Fly   635 VN-AARLQTDT---HF---SNYDAILRWWHDFGITLTASIFATLAFEAPI 677
            .| ...||..|   |.   ..:.|||        :..|::...|..||||
 Worm   448 FNWLPFLQAATSPIHLLLVLPFVAIL--------SFIAALIFYLFIEAPI 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3106NP_001285060.1 NRF 91..217 CDD:214781
Acyl_transf_3 286..635 CDD:280013 89/418 (21%)
OafA 289..702 CDD:224748 102/446 (23%)
rhy-1NP_495954.1 OafA 89..489 CDD:224748 100/450 (22%)
Acyl_transf_3 95..479 CDD:280013 97/434 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1171418at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.