DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg2 and PTPRS

DIOPT Version :10

Sequence 1:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_002841.3 Gene:PTPRS / 5802 HGNCID:9681 Length:1948 Species:Homo sapiens


Alignment Length:354 Identity:135/354 - (38%)
Similarity:183/354 - (51%) Gaps:63/354 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 ENPPSSASS-----GFSDDDSLAGQEGDPKPIDQI---VQMVKQRGRHGLIKEYADIRNRAPEGT 548
            :.|.|...|     ||..:..|:   ..|.||..:   .:.:|......|.:||..| :...:.|
Human  1347 QTPDSGLRSPLREPGFHFESMLS---HPPIPIADMAEHTERLKANDSLKLSQEYESI-DPGQQFT 1407

  Fly   549 FLHARMRANLTKNRYTDVLCYDHSRVVLAHEDGDEPSDYINANFVDGYKQKNAYISTQGPLPKTS 613
            :.|:.:..|..||||.:|:.||||||:|...:|...|||||||:||||:.:||||:||||||:|.
Human  1408 WEHSNLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETF 1472

  Fly   614 QDFWRMIWEQHCLVIVMTTRVMERGRVKCGQYW-----------EPTEESSLEFGDYHVRTISVE 667
            .|||||:|||....|||.||:.|:.|:||.|||           :.|...::|...:.|||.|:.
Human  1473 GDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLH 1537

  Fly   668 CNEDYMVASLELRNIKTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGDTW 732
            .|             .:.|.|.|..:|||:|||:|||......|.||::|:.             
Human  1538 KN-------------GSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKT------------- 1576

  Fly   733 AGHPRGPPIVVHCSAGIGRTGTFITLDICISRLEDVGTADIRGTVEKIRSQRAYSIQMPDQYVFC 797
            ...|...|||||||||:||||.||.:|..:.|::...|.|:.|.|..:||||.|.:|..|||.|.
Human  1577 CNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFI 1641

  Fly   798 HLALIE--------------YAYSRGMLQ 812
            |.||:|              |||.:.:.|
Human  1642 HEALLEAVGCGNTEVPARSLYAYIQKLAQ 1670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024
SEC14 170..314 CDD:469559
PTPc-N9 529..799 CDD:350391 117/280 (42%)
PTPRSNP_002841.3 I-set 33..124 CDD:400151
Ig strand B 50..54 CDD:409353
Ig strand C 63..67 CDD:409353
Important for binding to glycosaminoglycan chains. /evidence=ECO:0000250|UniProtKB:B0V2N1 68..72
Ig strand E 86..93 CDD:409353
Ig strand F 104..109 CDD:409353
Ig strand G 117..120 CDD:409353
IgI_2_RPTP_IIa_LAR_like 137..235 CDD:409400
Ig strand A' 143..147 CDD:409400
Ig strand B 150..159 CDD:409400
Ig strand C 164..170 CDD:409400
Ig strand C' 172..174 CDD:409400
Ig strand D 183..187 CDD:409400
Ig strand E 199..204 CDD:409400
Ig strand F 213..220 CDD:409400
Ig strand G 223..234 CDD:409400
IgI_3_RPTP_IIa_LAR_like 248..329 CDD:409401
Ig strand A 248..250 CDD:409401
Ig strand A' 254..258 CDD:409401
Ig strand B 261..269 CDD:409401
Ig strand C 274..280 CDD:409401
Ig strand C' 282..284 CDD:409401
Ig strand D 287..291 CDD:409401
Ig strand E 296..301 CDD:409401
Ig strand F 308..315 CDD:409401
FN3 318..>724 CDD:442628
Ig strand G 319..328 CDD:409401
FN3 <671..>981 CDD:442628
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 700..724
FN3 1037..>1097 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1311..1340
R-PTPc-S-1 1370..1651 CDD:350473 125/307 (41%)
R-PTP-S-2 1653..1942 CDD:350475 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.