DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg2 and PTPRF

DIOPT Version :10

Sequence 1:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster
Sequence 2:XP_005271136.1 Gene:PTPRF / 5792 HGNCID:9670 Length:1922 Species:Homo sapiens


Alignment Length:326 Identity:128/326 - (39%)
Similarity:182/326 - (55%) Gaps:45/326 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 PSSASSGFSDDDSLAGQEGDPKPIDQIVQMVKQ-RGRHGL--IKEYADIRNRAPEGTFLHARMRA 556
            |.|:.....:..|:  ::..|.||..:...::: :...||  .:||..| :...:.|:.::.:..
Human  1328 PGSSVPSCPNTSSM--RDHPPIPITDLADNIERLKANDGLKFSQEYESI-DPGQQFTWENSNLEV 1389

  Fly   557 NLTKNRYTDVLCYDHSRVVLAHEDGDEPSDYINANFVDGYKQKNAYISTQGPLPKTSQDFWRMIW 621
            |..||||.:|:.||||||:|...||...|||||||::|||:::||||:||||||:|..|||||:|
Human  1390 NKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVW 1454

  Fly   622 EQHCLVIVMTTRVMERGRVKCGQYW-----------EPTEESSLEFGDYHVRTISVECNEDYMVA 675
            ||....:||.||:.|:.||||.|||           :.|...::|...|.|||.:          
Human  1455 EQRTATVVMMTRLEEKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRTFA---------- 1509

  Fly   676 SLELRNIKTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHP-RGP 739
               |....:.|.|.:..:||.:|||:|||.....:|.||::|:              |.:| ...
Human  1510 ---LHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVK--------------ACNPLDAG 1557

  Fly   740 PIVVHCSAGIGRTGTFITLDICISRLEDVGTADIRGTVEKIRSQRAYSIQMPDQYVFCHLALIEY 804
            |:|||||||:||||.||.:|..:.|::...|.||.|.|..:||||.|.:|..|||||.|.||:|.
Human  1558 PMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEA 1622

  Fly   805 A 805
            |
Human  1623 A 1623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024
SEC14 170..314 CDD:469559
PTPc-N9 529..799 CDD:350391 117/283 (41%)
PTPRFXP_005271136.1 I-set 33..124 CDD:400151
Ig strand B 50..54 CDD:409353
Ig strand C 63..67 CDD:409353
Ig strand E 86..93 CDD:409353
Ig strand F 104..109 CDD:409353
Ig strand G 117..120 CDD:409353
IgI_2_RPTP_IIa_LAR_like 136..226 CDD:409400
Ig strand A 136..138 CDD:409400
Ig strand A' 143..147 CDD:409400
Ig strand B 150..159 CDD:409400
Ig strand C 164..170 CDD:409400
Ig strand C' 172..174 CDD:409400
Ig strand D 183..187 CDD:409400
Ig strand E 190..195 CDD:409400
Ig strand F 204..211 CDD:409400
Ig strand G 214..225 CDD:409400
IgI_3_RPTP_IIa_LAR_like 239..320 CDD:409401
Ig strand A 239..241 CDD:409401
Ig strand A' 245..249 CDD:409401
Ig strand B 252..260 CDD:409401
Ig strand C 265..271 CDD:409401
Ig strand C' 273..275 CDD:409401
Ig strand D 278..282 CDD:409401
Ig strand E 287..292 CDD:409401
Ig strand F 299..306 CDD:409401
Ig strand G 310..319 CDD:409401
FN3 <311..716 CDD:442628
FN3 714..820 CDD:238020
FN3 825..914 CDD:238020
FN3 923..1011 CDD:238020
FN3 1020..>1079 CDD:238020
R-PTPc-F-1 1350..1625 CDD:350474 122/302 (40%)
R-PTP-F-2 1627..1917 CDD:350477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.