DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg2 and PTPRD

DIOPT Version :10

Sequence 1:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001364887.1 Gene:PTPRD / 5789 HGNCID:9668 Length:1932 Species:Homo sapiens


Alignment Length:349 Identity:131/349 - (37%)
Similarity:186/349 - (53%) Gaps:60/349 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 PSSASSGFSDD---DSLAGQEGDPKPIDQI---VQMVKQRGRHGLIKEYADIRNRAPEGTFLHAR 553
            |.|..||:..:   .|:|..  .|.||.::   ::.:|........:||..| :...:.|:.|:.
Human  1335 PGSDDSGYPGNLHSSSMASH--PPIPILELADHIERLKANDNLKFSQEYESI-DPGQQFTWEHSN 1396

  Fly   554 MRANLTKNRYTDVLCYDHSRVVLAHEDGDEPSDYINANFVDGYKQKNAYISTQGPLPKTSQDFWR 618
            :..|..||||.:|:.||||||:|:..:|...|||:|||::|||:::||||:|||.||:|..||||
Human  1397 LEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWR 1461

  Fly   619 MIWEQHCLVIVMTTRVMERGRVKCGQYW-----------EPTEESSLEFGDYHVRTISVECNEDY 672
            |||||....:||.|::.||.||||.|||           :.|...::|...|.|||.::..|   
Human  1462 MIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKN--- 1523

  Fly   673 MVASLELRNIKTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHPR 737
                      .:.|.|.|..:|||:|||:|||......|.||::|:.             ...|.
Human  1524 ----------GSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKT-------------CNPPD 1565

  Fly   738 GPPIVVHCSAGIGRTGTFITLDICISRLEDVGTADIRGTVEKIRSQRAYSIQMPDQYVFCHLALI 802
            ..|:|||||||:||||.||.:|..:.|::...|.||.|.|..:|:||.|.:|..|||:|.|.||:
Human  1566 AGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALL 1630

  Fly   803 E--------------YAYSRGMLQ 812
            |              |||.:.:.|
Human  1631 EAVTCGNTEVPARNLYAYIQKLTQ 1654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024
SEC14 170..314 CDD:469559
PTPc-N9 529..799 CDD:350391 113/280 (40%)
PTPRDNP_001364887.1 I-set 24..115 CDD:400151
Ig strand B 41..45 CDD:409390
Ig strand C 54..58 CDD:409390
Ig strand E 77..84 CDD:409390
Ig strand F 95..100 CDD:409390
Ig strand G 108..111 CDD:409390
IgI_2_RPTP_IIa_LAR_like 127..226 CDD:409400
Ig strand A 127..129 CDD:409400
Ig strand A' 134..138 CDD:409400
Ig strand B 141..150 CDD:409400
Ig strand C 155..161 CDD:409400
Ig strand C' 163..165 CDD:409400
Ig strand D 174..178 CDD:409400
Interaction with IL1RAPL1. /evidence=ECO:0000250 180..189
Mini-exon peptide A9, sufficient for interaction with IL1RAPL1. /evidence=ECO:0000250|UniProtKB:Q64487 181..189
Ig strand E 190..195 CDD:409400
Ig strand F 204..211 CDD:409400
Ig strand G 214..225 CDD:409400
Mini-exon peptide B, required for interaction with SLITRK2 and in the function in pre-synaptic differentiation, Acts as an adjustable linker to control relative positions and orientations of the PTPRD second and third immunoglobilin domains for their simultaneous interactions with the first immunoglobilin domain of IL1RAPL1 and IL1RAP, Modulates affinity for IL1RAPL1 and IL1RAP. /evidence=ECO:0000250|UniProtKB:Q64487 227..230
IgI_3_RPTP_IIa_LAR_like 239..320 CDD:409401
Ig strand A 239..241 CDD:409401
Ig strand A' 245..249 CDD:409401
Ig strand B 252..260 CDD:409401
Ig strand C 265..271 CDD:409401
Ig strand C' 273..275 CDD:409401
Ig strand D 278..282 CDD:409401
Ig strand E 287..292 CDD:409401
Ig strand F 299..306 CDD:409401
FN3 304..>736 CDD:442628
Ig strand G 310..319 CDD:409401
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 603..623
fn3 713..812 CDD:394996
FN3 <789..1127 CDD:442628
FN3 922..1013 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1304..1324
R-PTPc-D-1 1354..1637 CDD:350472 121/311 (39%)
R-PTP-D-2 1638..1929 CDD:350476 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.