DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg2 and Ptp69D

DIOPT Version :9

Sequence 1:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_524048.2 Gene:Ptp69D / 39443 FlyBaseID:FBgn0014007 Length:1462 Species:Drosophila melanogaster


Alignment Length:300 Identity:106/300 - (35%)
Similarity:163/300 - (54%) Gaps:23/300 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 DPKPIDQIVQMVKQRGRH-----GLIKEYADIRNRAPEGTFLHARMRANLTKNRYTDVLCYDHSR 573
            |..||.::......:.||     |.::||..:.||..:.|..::.::.|..||||.|:..||.:|
  Fly   869 DAGPIHRLDLENAYKNRHKDTDYGFLREYEMLPNRFSDRTTKNSDLKENACKNRYPDIKAYDQTR 933

  Fly   574 VVLAHEDGDEPSDYINANFVDGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVIVMTTRVMERG 638
            |.||..:|.:.:||||||||.|||::..:|..|||:..|..||||||||||..:|||.|.:.|..
  Fly   934 VKLAVINGLQTTDYINANFVIGYKERKKFICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYN 998

  Fly   639 RVKCGQYWEPTEESSLEFGDYHVRTISVECNEDYMVASLELRNIKT-----DEIRNVSHWQFTSW 698
            :.||.:||......:.:|||..|:........||:..:|.:...|.     ::.|.::.:.:.:|
  Fly   999 KAKCAKYWPEKVFDTKQFGDILVKFAQERKTGDYIERTLNVSKNKANVGEEEDRRQITQYHYLTW 1063

  Fly   699 PDYGVPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHPRGPPIVVHCSAGIGRTGTFITLDICIS 763
            .|:..|.....::.|::::..     |..|       .|| ||:||||||:|||||.:.||..|.
  Fly  1064 KDFMAPEHPHGIIKFIRQINS-----VYSL-------QRG-PILVHCSAGVGRTGTLVALDSLIQ 1115

  Fly   764 RLEDVGTADIRGTVEKIRSQRAYSIQMPDQYVFCHLALIE 803
            :||:..:..|..||..:|.||.:.:|...||:|.:.||::
  Fly  1116 QLEEEDSVSIYNTVCDLRHQRNFLVQSLKQYIFLYRALLD 1155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024
SEC14 170..314 CDD:238099
Y_phosphatase 557..803 CDD:278528 95/250 (38%)
PTPc 559..803 CDD:238006 94/248 (38%)
Ptp69DNP_524048.2 IG_like 139..233 CDD:214653
Ig 150..221 CDD:143165
fn3 237..321 CDD:278470
FN3 339..432 CDD:238020
FN3 439..535 CDD:238020
PTPc 892..1155 CDD:214550 101/275 (37%)
PTPc 920..1155 CDD:238006 94/247 (38%)
PHA02694 <1121..1206 CDD:177476 12/34 (35%)
PTPc 1186..1449 CDD:214550
PTPc 1216..1449 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443559
Domainoid 1 1.000 156 1.000 Domainoid score I1041
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46470
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19134
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.