DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg2 and M01A12.4

DIOPT Version :9

Sequence 1:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001032978.1 Gene:M01A12.4 / 3896722 WormBaseID:WBGene00044616 Length:232 Species:Caenorhabditis elegans


Alignment Length:155 Identity:34/155 - (21%)
Similarity:62/155 - (40%) Gaps:15/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   641 KCGQYWEPTE-ESSLEFGDYHVRTISV-ECNEDYMVASLELRNIKTDEIRNVSHWQF----TSWP 699
            :.|.|:.|.| |:...|..|.::||.: :..:...|...||::.|..:..|......    ||..
 Worm    17 EAGGYFVPKEGETFTSFQKYQMKTIGIFDEKQGVTVYQCELKSYKAPKKLNRRMIYIICCDTSVG 81

  Fly   700 DYGVPSSAMAMLNFLQKVREKQAQLVQG--LGDTWAGHPRGPPIVVHCSAGIGRTGTFITLDICI 762
            ....|.....::.::....|..| :..|  |.|.      ...::||..||..|..:|:...:..
 Worm    82 SIRSPRQQTVIMEYMWAFEEANA-IENGVALADA------KTTVLVHAIAGTRRCASFVATSVMC 139

  Fly   763 SRLEDVGTADIRGTVEKIRSQRAYS 787
            .:|.:.|......|..::|.:||::
 Worm   140 KQLLEAGNFSAMETWFEMRKRRAHT 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024
SEC14 170..314 CDD:238099
Y_phosphatase 557..803 CDD:278528 34/155 (22%)
PTPc 559..803 CDD:238006 34/155 (22%)
M01A12.4NP_001032978.1 PTPc <1..181 CDD:214550 34/155 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.