DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg2 and Ptprf

DIOPT Version :10

Sequence 1:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster
Sequence 2:XP_038966082.1 Gene:Ptprf / 360406 RGDID:3453 Length:1924 Species:Rattus norvegicus


Alignment Length:326 Identity:127/326 - (38%)
Similarity:182/326 - (55%) Gaps:45/326 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 PSSASSGFSDDDSLAGQEGDPKPIDQIVQMVKQ-RGRHGL--IKEYADIRNRAPEGTFLHARMRA 556
            |.|::....:..|:  ::..|.||..:...::: :...||  .:||..| :...:.|:.::....
  Rat  1330 PGSSAPSCPNISSM--RDHPPIPITDLADNIERLKANDGLKFSQEYESI-DPGQQFTWENSNSEV 1391

  Fly   557 NLTKNRYTDVLCYDHSRVVLAHEDGDEPSDYINANFVDGYKQKNAYISTQGPLPKTSQDFWRMIW 621
            |..||||.:|:.||||||:|...||...|||||||::|||:::||||:||||||:|..|||||:|
  Rat  1392 NKPKNRYANVIAYDHSRVLLTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVW 1456

  Fly   622 EQHCLVIVMTTRVMERGRVKCGQYW-----------EPTEESSLEFGDYHVRTISVECNEDYMVA 675
            ||....:||.||:.|:.||||.|||           :.|...::|...|.:||.:          
  Rat  1457 EQRTATVVMMTRLEEKSRVKCDQYWPARGTETYGLIQVTLVDTVELATYTMRTFA---------- 1511

  Fly   676 SLELRNIKTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHP-RGP 739
               |....:.|.|.:..:||.:|||:|||.....:|.||::|:              |.:| ...
  Rat  1512 ---LHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVK--------------ACNPLDAG 1559

  Fly   740 PIVVHCSAGIGRTGTFITLDICISRLEDVGTADIRGTVEKIRSQRAYSIQMPDQYVFCHLALIEY 804
            |:|||||||:||||.||.:|..:.|::...|.||.|.|..:||||.|.:|..|||||.|.||:|.
  Rat  1560 PMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEA 1624

  Fly   805 A 805
            |
  Rat  1625 A 1625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024
SEC14 170..314 CDD:469559
PTPc-N9 529..799 CDD:350391 116/283 (41%)
PtprfXP_038966082.1 I-set 33..124 CDD:400151
Ig strand B 50..54 CDD:409353
Ig strand C 63..67 CDD:409353
Ig strand E 86..93 CDD:409353
Ig strand F 104..109 CDD:409353
Ig strand G 117..120 CDD:409353
IgI_2_RPTP_IIa_LAR_like 136..232 CDD:409400
Ig strand A 136..138 CDD:409400
Ig strand A' 143..147 CDD:409400
Ig strand B 150..159 CDD:409400
Ig strand C 164..170 CDD:409400
Ig strand C' 172..174 CDD:409400
Ig strand D 183..187 CDD:409400
Ig strand E 196..201 CDD:409400
Ig strand F 210..217 CDD:409400
Ig strand G 220..231 CDD:409400
IgI_3_RPTP_IIa_LAR_like 241..322 CDD:409401
Ig strand A 241..243 CDD:409401
Ig strand A' 247..251 CDD:409401
Ig strand B 254..262 CDD:409401
Ig strand C 267..273 CDD:409401
Ig strand C' 275..277 CDD:409401
Ig strand D 280..284 CDD:409401
Ig strand E 289..294 CDD:409401
FN3 294..718 CDD:442628
Ig strand F 301..308 CDD:409401
Ig strand G 312..321 CDD:409401
FN3 598..1065 CDD:442628
PTP_DSP_cys 1352..1627 CDD:475123 121/302 (40%)
R-PTP-F-2 1629..1919 CDD:350477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.