DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg2 and Lar

DIOPT Version :10

Sequence 1:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001260594.1 Gene:Lar / 35259 FlyBaseID:FBgn0000464 Length:2032 Species:Drosophila melanogaster


Alignment Length:36 Identity:13/36 - (36%)
Similarity:17/36 - (47%) Gaps:6/36 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IDPRYDTKWNMLRWLQSNDFNIPKTVHLLKKHLKWR 65
            ||..||   .:|..|:|..:   ||..||...:.||
  Fly   398 IDKHYD---ELLHKLRSGGW---KTERLLSPSITWR 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024
SEC14 170..314 CDD:469559
PTPc-N9 529..799 CDD:350391
LarNP_001260594.1 I-set 36..129 CDD:400151
Ig strand B 53..57 CDD:409353
Ig strand C 66..70 CDD:409353
Ig strand E 93..97 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 122..125 CDD:409353
Ig 141..228 CDD:472250
Ig strand B 157..161 CDD:409353
Ig strand C 170..174 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 218..221 CDD:409353
IgI_3_RPTP_IIa_LAR_like 237..319 CDD:409401
Ig strand A 237..239 CDD:409401
Ig strand A' 244..248 CDD:409401
Ig strand B 251..259 CDD:409401
Ig strand C 264..270 CDD:409401
Ig strand C' 272..274 CDD:409401
Ig strand D 277..281 CDD:409401
Ig strand E 286..291 CDD:409401
Ig strand F 298..305 CDD:409401
Ig strand G 309..318 CDD:409401
FN3 322..411 CDD:238020 6/15 (40%)
FN3 <382..747 CDD:442628 13/36 (36%)
FN3 712..810 CDD:238020
FN3 832..898 CDD:214495
FN3 <867..1269 CDD:442628
fn3 914..998 CDD:394996
R-PTPc-LAR-1 1498..1735 CDD:350401
R-PTP-LAR-2 1784..2021 CDD:350402
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.