DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg2 and Ptp36E

DIOPT Version :9

Sequence 1:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster


Alignment Length:450 Identity:117/450 - (26%)
Similarity:190/450 - (42%) Gaps:130/450 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 SASGGATTAASAATEPNENITINGLSPSHRQAAN-------NSSSSSSSAATVANPLKLNTSGSA 459
            :|:||.::.|.           .|.:..||..::       .....|.:..::.|.:||:...|.
  Fly     3 AATGGGSSGAG-----------GGKTGKHRSRSSARYDDVEKQQRKSRAIVSIPNTIKLSMLNSG 56

  Fly   460 ------------DNNSTITNATTAAGAAGAAAGTTTNGGGEFWSENPPSSASSGFSDDDSLAGQE 512
                        |.|::::.             |..||                           
  Fly    57 LLSFERIKLEARDENNSLSK-------------TIPNG--------------------------- 81

  Fly   513 GDPKPIDQIVQMVKQRGRHGLIKEYADIRNRAP--------------EGTFLHARMRANLTKNRY 563
                |||.         ||.|  :..|:|.:.|              ..|..||..:.||.||:.
  Fly    82 ----PIDI---------RHFL--KLCDLRRKFPVLYKLEFQTAAKVESNTCRHALKKNNLEKNQN 131

  Fly   564 TDVLCYDHSRVVLAHEDGDEPSDYINANFVDGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVI 628
            ...:.||::||||....|.:.|||:||::||...:.||||.||||:.:|.|.:|||:|:::...|
  Fly   132 PKCIPYDYNRVVLEKVGGLQDSDYVNASYVDSLLKPNAYIVTQGPVEETVQAYWRMVWQENISAI 196

  Fly   629 VMTTRVMERGRVKCGQYWEPTEESSLEFGD-------------YHVRTISV-ECNEDYMVASLEL 679
            ||.|:..:..:|.|.|||.|..|...::||             :|:||..: :.||...|     
  Fly   197 VMLTKTFDFAKVMCHQYWPPNMEVHEQYGDIFINIVREEQLANFHIRTFRLYKMNEKQEV----- 256

  Fly   680 RNIKTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHPRGPPIVVH 744
                ||| |.:..:.:|.|..:..|.| .|:|.|.::||.....:::...|.     || ||:||
  Fly   257 ----TDE-RLILQFHYTEWYSHSCPFS-NALLEFRRRVRLVVGNIIKDEDDM-----RG-PILVH 309

  Fly   745 CSAGIGRTGTFITLDICISRLEDVGTADIRGTVEKIRSQRAYSIQMPDQYVFCHLALIEY 804
            ||.|.||:|.::::|..:...|:....::.|.::|:|..|...::..:||.|.:..|.|:
  Fly   310 CSDGGGRSGVYMSIDANLELAEEEECFNVFGYLKKLRQSRKGLVENVEQYKFIYDTLEEH 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024
SEC14 170..314 CDD:238099
Y_phosphatase 557..803 CDD:278528 87/259 (34%)
PTPc 559..803 CDD:238006 85/257 (33%)
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 87/259 (34%)
Y_phosphatase 428..671 CDD:395053
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443557
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19134
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.