DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg2 and Y116A8C.33

DIOPT Version :9

Sequence 1:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_503035.1 Gene:Y116A8C.33 / 178488 WormBaseID:WBGene00013809 Length:712 Species:Caenorhabditis elegans


Alignment Length:187 Identity:39/187 - (20%)
Similarity:61/187 - (32%) Gaps:53/187 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   418 NENITINGLSPSHRQAANNSSSSSSSAATVANPLKLNTSGSA----------------------D 460
            ||.|.|:|:..|:|. ::.|:..|.:...:.:.||..:.||.                      |
 Worm    63 NETIAIDGILNSYRN-SDISNFKSENILKLIDDLKATSMGSEQEVLKVESQLIKYNTFIDELKFD 126

  Fly   461 NNSTITNA-----TTAAGAAGAAAGTTTNGG----------GEF--WSE---NPPSSASSGFSDD 505
            .|:...:.     .|....|.....:|.||.          ||.  |.|   |.|.:.:......
 Worm   127 GNTLELHGKYKFFDTLRDLAIDVKDSTDNGHRFIVDMLEYIGEMLQWLEEGLNVPFNITERTMSP 191

  Fly   506 DSLAGQEGDPKPIDQIVQMVKQRGRHGLIKEYADIRNRAPEGTFLHARMRANLTKNR 562
            ..|..:.|.       :.:.....||   .||.:..|::.|.||...|....|..:|
 Worm   192 QFLLEKLGS-------IMLKVSSVRH---VEYLEGMNKSIESTFKPLREMFKLMNDR 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024
SEC14 170..314 CDD:238099
Y_phosphatase 557..803 CDD:278528 2/6 (33%)
PTPc 559..803 CDD:238006 1/4 (25%)
Y116A8C.33NP_503035.1 WSN 36..96 CDD:391742 9/33 (27%)
235kDa-fam <54..576 CDD:130673 39/187 (21%)
BAR 110..>247 CDD:386243 26/139 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_2QR81
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.