DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg2 and C17H12.3

DIOPT Version :9

Sequence 1:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001379692.1 Gene:C17H12.3 / 177443 WormBaseID:WBGene00015929 Length:374 Species:Caenorhabditis elegans


Alignment Length:356 Identity:111/356 - (31%)
Similarity:161/356 - (45%) Gaps:54/356 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   476 GAAAGTTTNGGGEFWSENPPSSASSGFS-DDDSLAGQEGDPKP--------------IDQIVQMV 525
            |....|.|.      :|..|.....|.: .|:.:|.....|.|              ::|.||..
 Worm    12 GKKGNTKTE------NERGPKKDKGGKTIVDEDIATTITAPPPNASQQPQLVQAHPIVEQFVQRA 70

  Fly   526 KQRGRHGLIKEYADI-RNRAPEGT--FLHARMRANL--TKNRYTDVLCYDHSRVVLAHEDGDEPS 585
            ...|...|..|:..: :...|:.|  ..:|...||:  |||||.||.|.|.:.|::|....  ||
 Worm    71 LDYGVEKLRDEFRQMAKYTRPDMTQNAFNANQSANINETKNRYADVPCQDQNIVLVAKPPA--PS 133

  Fly   586 DYINANFVD-GYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVIVMTTRVMERGRVKCGQYWEPT 649
            ||::||||. .......:|.|||||..|..|||.||.:|....|||..:.:|.|:.||.|||...
 Worm   134 DYVHANFVGCPMVPDKRFICTQGPLDHTVDDFWWMIVQQKVEQIVMLCKTIETGKYKCAQYWPLA 198

  Fly   650 EESSLEF-GDYHVRTIS----VECNEDYMVASLELRNIKTDEIRNVSHWQFTSWPDYGVPSSAMA 709
            .....|. |...|..:|    ::.:.:..:.:|::.  ..|:..:|.|..::.|||.|||...:.
 Worm   199 MGEKKEVKGGIVVENVSGTKPMDRDAEIQITTLQVS--FGDQKMSVRHLHWSDWPDRGVPPCKLT 261

  Fly   710 MLNFLQKVREKQAQLVQGLGDTWAGHPRGPPIVVHCSAGIGRTGTFITLDICISRL-EDVGTADI 773
            .|..|..||..:.                 |||||||||||||||.:.::..:.|: |:.....:
 Worm   262 SLELLSAVRGSRV-----------------PIVVHCSAGIGRTGTIVAIEYILERIAENKQCPPM 309

  Fly   774 RGTVEKIRSQRAYSIQMPDQYVFCHLALIEY 804
            ...|:.:|.|||||||...||::.|..::.|
 Worm   310 PDLVKSLRDQRAYSIQTDMQYLYIHRVMLNY 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024
SEC14 170..314 CDD:238099
Y_phosphatase 557..803 CDD:278528 90/254 (35%)
PTPc 559..803 CDD:238006 89/250 (36%)
C17H12.3NP_001379692.1 PTPc 77..339 CDD:214550 96/282 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.