DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg2 and Y48G9A.9

DIOPT Version :9

Sequence 1:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001022893.1 Gene:Y48G9A.9 / 175343 WormBaseID:WBGene00021702 Length:361 Species:Caenorhabditis elegans


Alignment Length:325 Identity:104/325 - (32%)
Similarity:158/325 - (48%) Gaps:46/325 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   518 IDQIVQMVKQRGRHGLIKEYADIRNRAPEGTFLHARMRANLTKNRYTDVLCYDHSRVVLAHEDGD 582
            ::..:...::.|..||.|:|..: :...:.:......:.|:.||||:||:|.|.:||.|. .|..
 Worm    57 LNNFIIATEKLGIEGLAKQYRKL-DAQQDSSLTFEAFKQNMHKNRYSDVVCRDTTRVKLT-IDKS 119

  Fly   583 EPSDYINANFVDGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVIVMTTRVMERGRVKCGQYWE 647
            ...|||:||:|.....:|.:|.|||||..|..||||||:::....|:|..:.||.||.||..|| 
 Worm   120 RYEDYIHANYVKTNYLRNTFICTQGPLQHTIIDFWRMIFQERAESILMLCKTMEEGRPKCVGYW- 183

  Fly   648 PTEESSLEFGDYHVRTISVECNEDYMVASLELR----NIKTD-------EIR-NVSHWQFTSWPD 700
            |:...:..:|...|..:. |.::::.:.:|.:.    |:..|       |:| |:..|  .:|||
 Worm   184 PSLGVTETYGCIRVTNMG-ESSDEFEICNLAVTFVPDNVPVDEQPANLKELRVNLIKW--PNWPD 245

  Fly   701 YGVPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHPRGPPIVVHCSAGIGRTGTFITLDICISRL 765
            .|||.             ||...:.|.|    ....|..|.||||||||||||..:.|:...::|
 Worm   246 RGVPD-------------EKCHTVPQRL----LAQVRHGPCVVHCSAGIGRTGCVVALEFAYNKL 293

  Fly   766 EDVGTADIRGTVEKIRSQRAYSIQMPDQYVFCHLALIEYAYSRG-------MLQTVD--LAGFDE 821
            :.....|....:.::|.|||..||...||::.|..:|  |::||       .|...|  |..:||
 Worm   294 DRGLKVDFEEIITELRKQRAQCIQTEIQYLYIHRVMI--AFARGETDVSEKALAAADAFLKSYDE 356

  Fly   822  821
             Worm   357  356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024
SEC14 170..314 CDD:238099
Y_phosphatase 557..803 CDD:278528 90/257 (35%)
PTPc 559..803 CDD:238006 89/255 (35%)
Y48G9A.9NP_001022893.1 PTPc 71..330 CDD:214550 94/281 (33%)
PTPc 97..330 CDD:238006 89/254 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.