DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg2 and T22C1.8

DIOPT Version :9

Sequence 1:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_492194.1 Gene:T22C1.8 / 172571 WormBaseID:WBGene00011918 Length:591 Species:Caenorhabditis elegans


Alignment Length:270 Identity:106/270 - (39%)
Similarity:145/270 - (53%) Gaps:30/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   556 ANLTKNRYTDVLCYDHSRVVLAHEDGDEPSDYINANFVDGYKQKNA-YISTQGPLPKTSQDFWRM 619
            ||.|||||.||:|.|.:||:|:  ||.: .|||:||:|:|.   || :|.|||....|..|||||
 Worm   150 ANPTKNRYKDVVCNDITRVILS--DGGD-GDYIHANYVNGL---NAPFILTQGATAATVIDFWRM 208

  Fly   620 IWEQHCLVIVMTTRVMERGRVKCGQYWEPTEESSLEFGDYHVRTISVECNEDYMV--ASLELRNI 682
            :.......|||...|||.|:.||.||:......::.||.:.: ..|:|.::|..:  .:|.:||:
 Worm   209 VVHTKTAYIVMLCEVMEDGKAKCAQYYPEKAGEAMTFGAWTI-LCSLEDDKDANIIKRTLSVRNV 272

  Fly   683 KTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHPRGPPIVVHCSA 747
            ...:...:.|....||||..||:|.||:|..|..||            |.:|     |:.|||||
 Worm   273 DNGKEHILKHLHTKSWPDRCVPNSTMALLRMLYIVR------------TASG-----PVTVHCSA 320

  Fly   748 GIGRTGTFITLDICISRLEDVGTADIRGTVEKIRSQRAYSIQMPDQYVFCHLALIEYAYSRGMLQ 812
            ||||||||:.::.|:..|.|....|:.||...:|:.||.|||:..||:.....||.|....|...
 Worm   321 GIGRTGTFVAIEACLQILTDGKELDLLGTCRALRNSRAGSIQVDIQYMALVQILINYGKDNGYWD 385

  Fly   813 TVDLAGFDER 822
            ..||   |:|
 Worm   386 DSDL---DDR 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024
SEC14 170..314 CDD:238099
Y_phosphatase 557..803 CDD:278528 98/248 (40%)
PTPc 559..803 CDD:238006 97/246 (39%)
T22C1.8NP_492194.1 PTPc 130..376 CDD:214550 99/249 (40%)
PTPc 153..376 CDD:238006 97/246 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000704
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.