DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg2 and C55B7.3

DIOPT Version :9

Sequence 1:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001367695.1 Gene:C55B7.3 / 172359 WormBaseID:WBGene00016942 Length:346 Species:Caenorhabditis elegans


Alignment Length:342 Identity:107/342 - (31%)
Similarity:162/342 - (47%) Gaps:49/342 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 SENPPSSASSGFSDDDSLAGQEGDPKPIDQIVQMVKQRGRHGLIKEYADIRNRAPEGTFLHARMR 555
            :|:..||..|...|:.:|..::...|.|.:.||...::...||..|:..:| |..:...:.|...
 Worm    14 TESANSSTKSSVLDEPTLVERKQQKKQILKFVQRTLEKMPQGLRAEFVGMR-RFNDFEKMKAFKE 77

  Fly   556 A-NLTKNRYTDVLCYDHSRVVLAHEDGDEPSDYINANFVDGYKQKNAYISTQGPLPKTSQDFWRM 619
            | ...||||.||.|.|::||.|   :|..|.:||:||:|........:|.||.||.||..|||.|
 Worm    78 AQEAGKNRYKDVGCLDNNRVKL---EGPWPHEYIHANYVATPTNPKRFICTQAPLEKTCADFWYM 139

  Fly   620 IWEQHCLVIVMTTRVMERGRVKCGQYWEPTEESSLEFGDYHVRTISVECNED--YMVASLELRNI 682
            .::.....|.|...::|:|..||.:|:...:...::| :...:.|||:|...  |...|....|:
 Worm   140 CYQDKVEYIFMLCNLLEKGARKCFEYFPSKKGDVMDF-EEGGQKISVKCESSVTYSFRSDAKANV 203

  Fly   683 KTDEI---------RNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHPRG 738
            ...||         |..:|:.:..|||.|||::.||:|..|:..|                 |..
 Worm   204 TATEIVIEGPGEKTRKTTHYHWNDWPDRGVPAADMAVLELLENAR-----------------PSK 251

  Fly   739 PPIVVHCSAGIGRTGTFITLDICISRLEDVGTADIRGTV--------EKIRSQRAYSIQMPDQYV 795
            .||||||||||||||:.:.|:..:.:|       :.|.:        .|||.||..|||...||:
 Worm   252 GPIVVHCSAGIGRTGSVVMLEYIMDQL-------LAGQIIDDGEKILVKIREQRNNSIQTDAQYL 309

  Fly   796 FCHLALIEYAYSRGMLQ 812
            |.|..::.|...:.:::
 Worm   310 FVHQVILNYFRKKKLME 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024
SEC14 170..314 CDD:238099
Y_phosphatase 557..803 CDD:278528 89/264 (34%)
PTPc 559..803 CDD:238006 89/262 (34%)
C55B7.3NP_001367695.1 Y_phosphatase 83..317 CDD:395053 89/261 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.