DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and pkdc

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:234 Identity:59/234 - (25%)
Similarity:97/234 - (41%) Gaps:55/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 CRESLESNSSKVDQNAVLVLENLRSSG------YVSGQRLKAFDLAHTLLALKYMAEFHALSLAL 180
            ||..|...:....:..::|||:|..:|      ||:...:||        .|.::|.||||.|  
Zfish    93 CRVPLCLAAKSFGEEQLIVLEDLDVAGFPVRKTYVNDAEIKA--------CLSWIANFHALFL-- 147

  Fly   181 RILRPEVFREQVRPFFKKFDWHAEAPEWKSVMKAETLEDIRRATNNDSRLVARMKELSDQFFEFL 245
                 :|..|.:.|....  ||.|.       :.|.||.:     :|.:|.|...|: |....  
Zfish   148 -----DVTPEGLWPIGTY--WHLET-------RPEELEAM-----SDQKLKAAAGEI-DSILN-- 190

  Fly   246 AAAPDRPDGPFTSIIHCDFWINNIMFRYGPTGTPVELKIIDFQTAQYDSVVHDIISFLLSSVDTA 310
                   :..|.:|:|.|..:.|..|    :...:::..:|||.......:.|:|.||.|.:|..
Zfish   191 -------NCRFKTIVHGDAKLANFCF----SKDGLQVASVDFQYVGGGCGMKDVIYFLGSCMDER 244

  Fly   311 ILEVEFEHMLEAYYEAFERCL-RRVG-AKLEVHTFKEFR 347
            ..|.:...:|:.|:....:.| ::|. |:||    ||:|
Zfish   245 ECEKKAPGLLDYYFSELRKSLEKKVDFAELE----KEWR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 52/219 (24%)
APH <214..329 CDD:279908 26/114 (23%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 50/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.