DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CHKov1

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001097918.1 Gene:CHKov1 / 43067 FlyBaseID:FBgn0045761 Length:410 Species:Drosophila melanogaster


Alignment Length:355 Identity:89/355 - (25%)
Similarity:158/355 - (44%) Gaps:71/355 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVDKLPE---IRALSEVVEPHVSG-SRLLNYHTSSLTKPGDNYGSVLLAIHARLQKSNGESFEE 61
            |...|:|:   .....:|::.:|.| |::.|:.....:..||||.:.:|.::..::..:|.:.|.
  Fly     1 MAAGKIPDWVTAERFEDVLKSNVDGYSKVRNFKAEMGSAAGDNYATNMLRVNIEVELQDGTTKEL 65

  Fly    62 QLVAKVP---PIDP---KYWQFFQPEQTCLTENAVYKILAPALATLQDEAGVPDESQFKGFPRFY 120
            ..:.|:|   .|:.   |:...|:.|:|      :|.::.|.:..|...|||  |..|       
  Fly    66 SYMVKLPRQREINKEMMKHNNIFEIERT------MYNLVVPEMEALYKAAGV--EVTF------- 115

  Fly   121 GCRESLESNSSKVDQNAVLVLENLRSSGYVSGQRLKAFDLAHTLLALKYMAEFHALSLALRILR- 184
                ..:|...|..|...:.||:|...|:.:..||:..|.|||...|:.:|::|| :.|:|:.. 
  Fly   116 ----GAKSYELKNAQTEYISLEDLCIKGFKNANRLEGLDQAHTERVLRKLAQWHA-ATAVRVATK 175

  Fly   185 ---PEV-----FREQVRPF-----------FKKFDWHAEAPEWKSVMKAETLEDIRRATNNDSRL 230
               ||:     |:|:.||.           |.|.....|..| ..:.|.:.|:|:          
  Fly   176 GQYPEIVLNGFFKEENRPMMNDMMNGMGQVFVKCCSTYEGNE-AYIEKVKALKDV---------- 229

  Fly   231 VARMKELSDQFFEFLAAAPDRPDGPFTSIIHCDFWINNIMFRYGPTGTPVELKIIDFQTAQYDSV 295
                  :.|:.|:.....|..    |..:.|.|.|.|||||:|..:|...|:.::|||.::|.:|
  Fly   230 ------MIDELFKMCVVDPTE----FNVLNHGDSWSNNIMFQYDESGKIKEVYMVDFQVSKYGTV 284

  Fly   296 VHDIISFLLSSVDTAILEVEFEHMLEAYYE 325
            ..|:..||:||........:|::.::.|::
  Fly   285 AQDLYYFLISSTKLEDKLSKFDYYVKVYHD 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 81/316 (26%)
APH <214..329 CDD:279908 29/112 (26%)
CHKov1NP_001097918.1 EcKinase 41..325 CDD:397213 81/315 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459612
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.