DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG10559

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster


Alignment Length:408 Identity:94/408 - (23%)
Similarity:166/408 - (40%) Gaps:83/408 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KPGDNYGSVLLAIHARLQKSNGESFEEQLVAKVPPIDPKYWQFFQPEQTCLTENAVYKILAPALA 99
            |||:||.:::|.:...::..:........:.|.|.....|.:..:.......|..|:..:.|.|.
  Fly    44 KPGENYSTIMLRLKLEVELQDHTIENVSYMLKTPYDFEMYREILRKNNMFAVERDVFIQVIPELE 108

  Fly   100 TLQDEAGVPDESQFKGFPRFYGCRESLESNSSKVD-QNAVLVLENLRSSGYVSGQRLKAFDLAHT 163
            .:..:.||..:...|.:               ::| .:..::|::|...|:.:..||:..|:.||
  Fly   109 QMYKDVGVEVKFGAKAY---------------EIDAPDDYVLLQDLGPLGFRNVDRLEGLDMVHT 158

  Fly   164 LLALKYMAEFHALSLALRILRPEVFREQVRPFFKKFDWHAEAPEWKSVMK---AETL-EDIRRAT 224
            ...||.||::||:| |.||                   |.:.|..::.::   |:|: |.|.:..
  Fly   159 KCVLKKMAQWHAVS-ATRI-------------------HLKGPYPQNYLQPTYADTMKESIEQVA 203

  Fly   225 NNDSRLVARMKELSDQFFEFLAA----------------APDRPDGPFTSIIHCDFWINNIMFRY 273
            ....:...:...|.:.:.|:.||                .||..|  |.::.|.|.|.:||||:|
  Fly   204 ETLGKYFLKCLPLYEGYEEYSAAVHKMQPKIVDLMYAMNTPDPQD--FNALNHGDCWTSNIMFKY 266

  Fly   274 -GPTGTPVELKIIDFQTAQYDSVVHDIISFLLSSVDTAILEVEFEHMLEAYYEAFERCLRRVG-- 335
             ..:..|:|...:|.|..:..||.:|:|.|||.|....|...:|::.::.|::.....||.:.  
  Fly   267 EDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHDHLVEHLRMLNYP 331

  Fly   336 -AKLEVHTFKEFRLEVKRVAYIQVPHAIFMTRFILADSALIGDSEAEERPKLTDVLKNT------ 393
             ||.....|    |..:.:.|.:|.:.|   .|||....|:   :..|...|||.:..|      
  Fly   332 EAKTPTLGF----LHTQLLKYGRVGYHI---AFILCPPVLL---DRTEDANLTDFVTETDNGDGL 386

  Fly   394 -----GSERISRKLSQIL 406
                 .:.|..:.:|.||
  Fly   387 KLAMYSNARYKKHVSAIL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 73/320 (23%)
APH <214..329 CDD:279908 35/132 (27%)
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 73/321 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459611
Domainoid 1 1.000 47 1.000 Domainoid score I8086
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.