DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG31370

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:391 Identity:82/391 - (20%)
Similarity:148/391 - (37%) Gaps:88/391 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GDNYGSVLLAIHARLQKSNGES-FEEQLVAKVPPIDPKYWQFFQPEQTCLTENAVYKILAPALAT 100
            ||||.||:  |.||::....:. |.:.|:.|.      ..:.|.......||..:|:.:.|..|.
  Fly    48 GDNYASVI--IRARVEYITQKGFFSKSLIIKT------VLEMFAGSALFKTEIGMYRKVLPEFAR 104

  Fly   101 LQDEAGVPDESQFKGFPRFYGCRESLESNSSKVDQNAVLVLENLRSSGYVSGQRLKAFDLAHTLL 165
            :..|..  |.|:......:|    |||.:.       |::.|:|....|.   .::...|.|..:
  Fly   105 ILRENN--DTSRLYAECIYY----SLEPSQ-------VMIFEDLGEMDYA---MVRDRVLTHGEI 153

  Fly   166 ALKY--MAEFHALSLALRILRPEVFREQVRPFFKKFDWHAEAPEWKSVMKAETLEDIRRATNNDS 228
            ...|  :|:|||||:.:...|||..:|     ||......:.|...|.|  ...:|         
  Fly   154 CGAYSKLAKFHALSMKIINERPEFVKE-----FKDGICLVDIPYMSSGM--GPFKD--------- 202

  Fly   229 RLVARMKELS--------------DQFFEFLAAAPDRPDGPFTSIIHCDFWINNIMFRYG-PTGT 278
             .:.|:.||.              |:..:.:......|...:..:.|.|:...|||.::. .:|.
  Fly   203 -FLGRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQPGYYVLCHGDYHTRNIMVKHNKESGG 266

  Fly   279 PVELKIIDFQTAQYDSVVHDII--SFLLSSVDTAILEVEFEHMLEAYYEAFERCLRRVG--AKL- 338
            ..:..::|:|......:..|::  .::|.:.:..|  .|.|.:|..|:......||::|  .|| 
  Fly   267 FEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRI--GELETLLNYYFSVLRETLRKIGYQGKLP 329

  Fly   339 -------EVHTFKEFRLEVKRVAYIQVPHAIFMTRFILADSALIGDSEAEER--PKLTDVLKNTG 394
                   |::..|::..             :|::.::.....|..::...|.  .||.|.::...
  Fly   330 DPPAFWKEMYRLKDYEF-------------LFLSTYLPMSVGLSLETATNEETDDKLQDFIEECK 381

  Fly   395 S 395
            |
  Fly   382 S 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 70/317 (22%)
APH <214..329 CDD:279908 21/131 (16%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 70/318 (22%)
APH <202..320 CDD:279908 21/129 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459650
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.