DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG13658

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster


Alignment Length:412 Identity:86/412 - (20%)
Similarity:153/412 - (37%) Gaps:123/412 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IRALSEVVEPHVSGSRLLNYHTSSLTKPGDNYGSVLLAIHARLQKSNGESFEEQLVAKVPPIDPK 73
            :||..:..|.||:..::     |..|..||:|.||:....:....:.| :|.:.|:.|.      
  Fly    30 LRAYEKDPELHVTDLKI-----SPATLQGDHYASVMFRAVSHYSTAKG-NFSKALIVKT------ 82

  Fly    74 YWQFFQPEQ------------TCLTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGCRESL 126
                 .|||            ...||..:|....|.|..:..|||  |.::... |..|   .||
  Fly    83 -----MPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAG--DTTKLYA-PCIY---HSL 136

  Fly   127 ESNSSKVDQNAVLVLENLRSSGYVSGQRLKAFDLAHTLLALKY------------MAEFHALSLA 179
            |.:.       |::.|:|...||             |::..:|            :|::||.|:.
  Fly   137 EPHQ-------VMIFEDLVPQGY-------------TVIRDRYPNKEELQKAFFKLAKWHAASMK 181

  Fly   180 LRILRPEVFREQVRPFFKKFDWHAEAPEW--KSVMKA------ETLEDIRRATNNDSRLVARMKE 236
            :...||:..:|     ||...|  ..|.:  .|::..      |.|:.:...|    :.....::
  Fly   182 VLNERPDFLKE-----FKYGLW--GMPNFLNDSIVTTGVPCFLEMLDKVPELT----KYKPYFEK 235

  Fly   237 LSDQFFEFLAAA---------PDRPDGPFTSIIHCDFWINNIMFRYG-PTGTPVELKIIDFQTAQ 291
            :.|.:.:.::|.         |:|    :..:.|.||...|:||||. .||:..::.::|||.:.
  Fly   236 IKDNYIQQMSAVMEEYRTNPKPNR----YYVLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISN 296

  Fly   292 YDSVVHDIISFLLSSVDTAILEVEFEHMLEAYYEAFERCLRRVGAKLE----------VHTFKEF 346
            ...:..|:|..:...:||.......:..:..|:......|:::|.|.|          :|..|::
  Fly   297 VCPLSIDLIYSIFMVMDTEDRWDLGKEYINYYFSVLADTLKKIGFKGEMPTQTGVWEHIHGHKDY 361

  Fly   347 RLEVKRVAYIQVPHAIFMTRFI 368
            ..             ..||.|:
  Fly   362 EF-------------FMMTSFL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 71/340 (21%)
APH <214..329 CDD:279908 25/130 (19%)
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 71/341 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459647
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.