DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG11878

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651369.1 Gene:CG11878 / 43050 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster


Alignment Length:424 Identity:107/424 - (25%)
Similarity:175/424 - (41%) Gaps:71/424 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YHTSSL------TKP----GDNYGSVLLAIHAR--LQKSNGESFEEQLV-AKVPPIDP------K 73
            :..|||      |||    |.|||||:..|:..  .:.|.|:.....|| ......||      .
  Fly    29 FKDSSLKLATLDTKPAVANGGNYGSVMTRINVEYTTKVSKGKQSTTFLVKTTFADRDPAGDVLIH 93

  Fly    74 YWQFFQPEQTCLTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGCRESLESNSSKVDQNAV 138
            |..:.:       |..:|:.:.|.||.:.       ..:.|...:.:....:::.....:     
  Fly    94 YGVYTR-------EMDIYEHILPQLADMV-------RKELKDSRKLFAATMNVDRERDSI----- 139

  Fly   139 LVLENLRSSGYVSGQRLKAFDLAHTLLALKYMAEFHALSLALRILRPEVF-REQVRPFFKKFDWH 202
             :.|::....|....|.|..||.||.|.|:.:|.|||.|..|...:|.:| :...|.||.|.. .
  Fly   140 -IFEDMSLDHYKVACRRKKLDLEHTHLVLEKLALFHAASSVLAERQPGIFDKNYDRGFFNKHT-R 202

  Fly   203 AEAPEWKSVMKAETLEDIRRATNNDSRLVARMKELSDQFFEFLAAAPDR----PDGPFTSIIHCD 263
            |.||     :....||.:.|:..:|..|..|.|...|:..|.|....:|    ..|.|.::.|.|
  Fly   203 AYAP-----IMTNLLEALSRSLASDEELGQRYKAKIDRLVERLMDYGERSTTSSPGDFLTLAHGD 262

  Fly   264 FWINNIMFRYGPTGTPVELKIIDFQTAQYDSVVHDIISFLLSSV-DTAILEVEFEHMLEAYYEAF 327
            .|..|.||:|.....|.....||||.:.::|...|:..|..:|: |...||.:.| :::.||...
  Fly   263 LWTTNFMFQYDAKEHPTNAIFIDFQFSVWNSPAIDLHYFFSTSLQDNLRLEHQTE-LVQFYYYRL 326

  Fly   328 ERCLRRVGAKLEVHTFKEFRLEVKRVAYIQVPHAIFMTRFILADSALIGDSEAEERPKLTDVL-- 390
            ...||::.....:.:..:|:|:.:...:    :|:|.:  ::.:..:  ..|.:|...:..||  
  Fly   327 TEALRKLKYAGRIPSLFDFQLQFRSRGF----YAVFCS--LIFEPVM--QYEGKEDASIEQVLSS 383

  Fly   391 -------KNT--GSERISRKLSQILNLAEKFDIL 415
                   ||:  .||.|.:|||..|...::|.:|
  Fly   384 SESGMRFKNSVYESENIKKKLSVTLPFLDQFGLL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 83/317 (26%)
APH <214..329 CDD:279908 35/119 (29%)
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 82/314 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459325
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.