DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG14314

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:424 Identity:97/424 - (22%)
Similarity:170/424 - (40%) Gaps:65/424 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VEPHVSGSRLLNYHTSSLTKPGDNYGSVLLAIHARLQKSNGE----SFEEQLVAKVPPIDPKYWQ 76
            |||.|   ::..:..:..:..||||.:.|..|     |..|:    .:|:.::.||.|......:
  Fly    38 VEPDV---QIDAFELAQGSDRGDNYTAALYRI-----KLTGKRRSLKWEQNVICKVMPESVVARE 94

  Fly    77 FFQPEQTCLTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGCRESLESNSSKVDQNAVLVL 141
            .::.::....|...|..:.|.|...|......|...|...|:.|..|..|            |::
  Fly    95 AYKSDKLFRNEVQFYNTIMPELLKFQASKTNQDTPVFNAIPKCYSARHDL------------LIM 147

  Fly   142 ENLRSSGYVSGQRLKAFDLAHTLLALKYMAEFHALSLALRILRPEVFREQVRPFFKKFDWHAEAP 206
            |:||..|:....|.|...|..|...|..:|:.|.||||.:..:|..|........:.....|...
  Fly   148 EDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKPLEFSNLCSMISEGIFCTANTS 212

  Fly   207 EWKSVMKAETLEDIRRATN---NDSRLVARMKEL--SDQFFEFLAAAPDRPDGPFTSIIHCDFWI 266
            .:::..:..|...|:..:.   .||:.|..|.:.  |..||..:..... .:.|.::|.|.|.|:
  Fly   213 WYRNYYERLTKNAIQMVSEVLPPDSKYVLAMNKFAESSSFFGRMVKLAS-TESPLSAICHGDCWV 276

  Fly   267 NNIMFRYGPTG--TPVELKIIDFQTAQYDSVVHDIISFLLSSVDTAILEVEFEHMLEAYYEAFER 329
            ||.::.|.|..  ..:|:.::|||..:|.|:..||.:.|.......:.:.:.:.:|:.|.|...|
  Fly   277 NNFLYHYDPEDPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTKEMRDAQLQTLLKIYTEELFR 341

  Fly   330 CLRRVGAKLEVH--TFKE----FRLEVKRVAYIQVPHAIFMTRFILA---DSALIGDSEAEERPK 385
            .|:.:...|..|  |.::    |..|:|...           ||.|.   |...|....:|:.|.
  Fly   342 WLQMLCTNLPDHCDTLQKLQDLFAEELKTYG-----------RFALGLALDILPISTCSSEDAPD 395

  Fly   386 L----TDVL-KNTGSERIS--------RKLSQIL 406
            :    :|.| ::.|:..::        :|:|:|:
  Fly   396 MYLDRSDELGEDVGAPTLNFPPNDLCRQKMSEIV 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 74/309 (24%)
APH <214..329 CDD:279908 30/121 (25%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 74/307 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.