DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG13813

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster


Alignment Length:411 Identity:95/411 - (23%)
Similarity:178/411 - (43%) Gaps:62/411 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RALSEVVEPHVSGSRLLNYHTSSLTKPGDN-YGSVLLAIHARLQKSNGESFEEQLVAKVPPIDPK 73
            |.|.|:.:.|  |..:::...:.:   |:| ||.||......:..:      ..:|.|:.|.:..
  Fly    12 RVLLELYQRH--GIPMVSQPMAGV---GENAYGQVLRVSWPTIVDA------ATVVVKMAPRNEA 65

  Fly    74 YWQFFQPEQTCLTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGCRESLESNSSKVDQNAV 138
            .............|..:|:.:.|....|.     ||.:.|...|       :|::|..|. .:..
  Fly    66 RRSHMHVVDYYAREVFMYQKVFPVFRALS-----PDRNTFTVAP-------ALQANDLKA-PDEF 117

  Fly   139 LVLENLRSSGYVSGQR--LKAFDLAHTLLALKYMAEFHALSLALRILRPEVFREQVRPFFKKFDW 201
            |:.|:|..||:....|  :..:|:  .:.:||.:||.||.|..|:...|..|::.|. |.:|.:.
  Fly   118 LIFEDLSESGFRPNSRCIMPTYDI--VVCSLKALAELHACSFILQQTDPLQFKQLVE-FVEKDNL 179

  Fly   202 HAEAPEWKSVMKAETLE----DIRRA----TNNDSRLVARMKE---LSDQFFEFLA--AAPDRPD 253
                  :.|.::..|:|    .:|:|    ..:|...||.::|   |.:...:.||  ....:..
  Fly   180 ------FTSDIEEVTIEFGKAQLRKARIILKESDGDQVAAVQEVLQLCENQLKSLALYCVDGKAQ 238

  Fly   254 GPFTSIIHCDFWINNIMFRYGP-TGTPVELKIIDFQTAQYDSVVHDIISFLLSSVDTAILEVEFE 317
            .|...|.|.|||.|||::|:.| :..|||.|:||||.::|...|.||:.:|.:..:..:.:..|.
  Fly   239 APHAVICHGDFWNNNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFP 303

  Fly   318 HMLEAYYEAFERCLRRVGAKLE-VHTFKEFRLEVKRVAYIQVPHAIFMTRFILADS--------- 372
            ..::|||...::.|:.....|| ::....|..::::.....:....|...|.::::         
  Fly   304 DFMDAYYNTMDQKLKSCNLSLEGIYPRSVFNRQLQQYGVYGLIMGAFSLPFFISNANEVIDIDTV 368

  Fly   373 --ALIGDSEAEERPKLTDVLK 391
              |:...|.:.:.||..::::
  Fly   369 SEAIQSISTSSDEPKYKELIE 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 81/315 (26%)
APH <214..329 CDD:279908 39/128 (30%)
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 81/314 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.