DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG11889

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster


Alignment Length:410 Identity:101/410 - (24%)
Similarity:167/410 - (40%) Gaps:65/410 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TKPGDNYGSVLLAIHAR-LQKSNGESFEEQLVAKVPPIDPKYWQFFQPEQTCL-------TENAV 90
            |..|:||.||:..|... :.|.:.::.....:.|....|.      .|....|       .|..:
  Fly    42 TANGENYASVMTRISVEYITKDSKDNQSATFLLKTTFADK------DPAAHLLINYGIYTREIDM 100

  Fly    91 YKILAPALATLQDEAGVPDE--SQFKGFPRFYGCRESLESNSSKVDQNAVLVLENLRSSGYVSGQ 153
            |:.:.|.||.:     |.:|  ...|.|....|.....:|          ::.|:|....|....
  Fly   101 YEQILPRLADI-----VKNELHDSRKLFAATVGVDRERDS----------IMFEDLSLERYKVAC 150

  Fly   154 RLKAFDLAHTLLALKYMAEFHALSLALRILRPEVFREQV-RPFFKKFDWHAEA--PEWKSVMKA- 214
            |:|..||.||.|.|:.:|:|||...||...:|.:|.:.. |.||.|   |...  |..|:::|| 
  Fly   151 RVKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNYDRGFFNK---HVRGYEPIMKNILKAL 212

  Fly   215 -ETLE---DIRRATNNDSRLVARMKELSDQFFEFLAAAPDRPDGPFTSIIHCDFWINNIMFRYGP 275
             .||:   |::      .|..|::..|.|...::...:.....|.|.::.|.|.|..|:||:|..
  Fly   213 SRTLDLSPDLK------ERYQAKIDRLIDNVMDYGERSTSVAPGDFVTLAHGDIWTTNVMFQYDD 271

  Fly   276 TGTPVELKIIDFQTAQYDSVVHDIISFLLSSV-DTAILEVEFEHMLEAYYEAFERCLRRVGAKLE 339
            .|.||....||||.:.::|...|:..|..:|: :...||.:.| :::.|:......|.||....:
  Fly   272 EGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTE-LVQFYFYKLVVALERVKYSGK 335

  Fly   340 VHTFKEFRLEVKRVAYIQVPHAIFMTRFILADSALIGDSEA---------EERPKLTDVLKNTGS 395
            |.:..||:.:.:...:    :|:|.:..........|..|.         |:..:|.|.:..|  
  Fly   336 VPSLFEFQQQFRTKGF----YAVFASLIFEPTMVYNGKEEPSIEQFMTSDEKGVRLRDAVYQT-- 394

  Fly   396 ERISRKLSQILNLAEKFDIL 415
            |...:||...|...::..:|
  Fly   395 EENLKKLHLTLPFLDQLGLL 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 83/317 (26%)
APH <214..329 CDD:279908 32/120 (27%)
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 84/318 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.