DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG9259

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster


Alignment Length:442 Identity:97/442 - (21%)
Similarity:172/442 - (38%) Gaps:75/442 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EIRAL-----SEVVEPHVSGSRLLNYHTSSLTKPGDNYGSVLLAIHARLQKSNGESFEE-QLVAK 66
            |||.|     .:.|....:|..::||.....:.....|....|.:|..|:..|.|...: ...:|
  Fly    11 EIRGLCQRYFHQDVSNSDTGFDIVNYTLKPTSDAPAGYLGSHLYLHVTLKLHNSEEVRQLTFFSK 75

  Fly    67 VPPI-DPKYWQFFQPEQTCLTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGCRESLESNS 130
            ..|: :....::.:.......|.|||:.:.|.|.....|..          |:.|          
  Fly    76 SAPVGNESRMEYLEDFGVFEKEIAVYQNVLPDLHKACAEVA----------PKCY---------- 120

  Fly   131 SKVDQNAVLVLENLRSSGYVSG---QRLKAFDLAHTLLALKYMAEFHALSL--------ALRILR 184
             ..|:| :|:.|||...||..|   ..|..::..|  ..||.:|..||.|:        .:...:
  Fly   121 -YADKN-LLIFENLADQGYRMGAGRDGLLTYEQLH--CCLKTLAAMHAGSIIQEQRTGQKIAQSQ 181

  Fly   185 PEVFREQVRPFFKKFDWHAEAPEWKSVMKAETL-----EDIRRATNNDSRLVARMKELSDQFFEF 244
            |:...|...|       ...:||...::..:..     |.|:......|:|...::..::: ..|
  Fly   182 PKSVVENAYP-------SDVSPEHMRMVNFQNACLVLKEFIKLIPKYQSKLDYVLENFTEK-MSF 238

  Fly   245 LAAAPDRPDGPFTSIIHCDFWINNIMFRYGPTG-TPVELKIIDFQTAQYDSVVHDIISFLLSSVD 308
            :..|....|....:|:|.|.|.|||||:||..| .|::.:::|||.|:|...|.|:::.|.....
  Fly   239 IFEAVKTSDVYQNTILHGDLWANNIMFQYGRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTIPTS 303

  Fly   309 TAILEVEFEHMLEAYYEAFERCLRRVGAKLEV------HTFKEFRLEVKRVAYIQVPHAIFMTRF 367
            ....:.....:|..||......|:|  |.|::      .||.|...:.:.|..|:  ..:|....
  Fly   304 KEFRDAHLSELLAEYYRFMTEFLKR--ADLDIARFIPEQTFYESVQKFRSVGLIE--SCLFCHLV 364

  Fly   368 IL-------ADSALIGDSEAEERPKLTDVLKNTGSERISRKLSQILNLAEKF 412
            ||       ..|::.|.::.....::...|:...::.:.|  |:::::.|.|
  Fly   365 ILPPHCTQKLTSSVDGFNDFFTNKRIEICLEAFNTDELYR--SRLVDMIEDF 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 72/317 (23%)
APH <214..329 CDD:279908 31/120 (26%)
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 68/302 (23%)
APH <252..325 CDD:279908 24/72 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459639
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.