DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG9498

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster


Alignment Length:379 Identity:88/379 - (23%)
Similarity:148/379 - (39%) Gaps:76/379 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EPHVSGSRLLNYH--TSSL-------------------TKPGDNYGSVLLAIHARLQK--SNGES 58
            |.::|....||.|  |.:|                   :.|||||.|.:..:.....:  ..|||
  Fly     7 EQNISVPEYLNEHFFTETLEEGLRESKVTLKEINFAWGSNPGDNYCSAIYRVGVSFARWADGGES 71

  Fly    59 -FEEQ--LVAKVPPIDPKYWQFFQPEQTCLTENAVYKILAPALATLQ--DEAGVPDESQFKGFPR 118
             ..||  |:.|..|| .:..||.:.....:.|...|..:.|.|..|.  |..|.          :
  Fly    72 PVTEQLSLIVKTIPI-TEATQFLEDVCVFIKEKQTYTDVLPRLDILSRGDTFGA----------K 125

  Fly   119 FYGCRESLESNSSKVDQNAVLVLENLRSSGYVSGQRLKAFDLAHTLLALKYMAEFHALSLALRIL 183
            :|        :|.|.....: |..:|...|:....|.|..|..|..|.|:.:.:|||.|:.|...
  Fly   126 YY--------HSVKTPVQTI-VFSDLTVEGFKVASREKGLDWNHASLILQQLGKFHATSMVLAKK 181

  Fly   184 RPEVFREQVRPFFKKFDWHAEAPEWKSVMKAETLED---------IRRATN--NDSRLVARMKEL 237
            .|.:.::..|....:          ..:||::|.|.         |:.:.:  ...::...::.|
  Fly   182 DPAIVKQYTRGMLSE----------DILMKSDTFEQMFGGFLKGLIKSSASWAGYEKISKHLQRL 236

  Fly   238 SDQFFEFLAAAP-DRPDGPFTSIIHCDFWINNIMFRY---GPTGTPVELKIIDFQTAQYDSVVHD 298
            .|.|....|.|| .|....:..:.|.|.|.||.|:.|   .....|.....:|||.:.|.|...|
  Fly   237 MDNFRNVCADAPRPRKGDRYVVLNHGDLWTNNFMYGYDNASQPDVPTRAIFVDFQLSFYGSPACD 301

  Fly   299 IISFLLSSVDTAILEVEFEHMLEAYYEAFERCLRRVGAKLE-VHTFKEFRLEVK 351
            :..||.:|:...:|:...|.:::.||.:|:..|..  |:.| :.::::.:.|::
  Fly   302 LNFFLNTSIKLQLLQERREELIKVYYASFKDALEY--ARFEDIPSYEDLQYELR 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 78/320 (24%)
APH <214..329 CDD:279908 32/129 (25%)
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 79/323 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459203
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.