DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG33509

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster


Alignment Length:400 Identity:81/400 - (20%)
Similarity:147/400 - (36%) Gaps:109/400 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RLLNYH----TSSLTKPGDNYGSVLLAIHARLQKSNGESFEEQLVAKVPPIDPKYWQFF---QPE 81
            :||:||    .|::...||.|...|...|.          ||:::.::        :.|   .|:
  Fly    22 KLLDYHLVRDLSAIGYLGDYYALTLRYCHE----------EEEIIREI--------ELFVKAMPQ 68

  Fly    82 QTC--------LTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGCRESLESNSSKVDQNAV 138
            |:.        ..|:.:|..|...|..|         |..|..|.....|:.|            
  Fly    69 QSAELSKESIFQKESWLYDTLIKKLQAL---------SNVKWSPNCVYSRKDL------------ 112

  Fly   139 LVLENLRSSGYVSGQRLKAFDLAHTLLALKYMAEFHALSLALRILRPEVFREQVRPFFKKFDWHA 203
            :||||::..|:.|....:..::....| :|.:|.||:.||        |:..|.    |....|.
  Fly   113 MVLENIKLKGFTSAGSAELNEVFVKPL-IKSIAAFHSASL--------VYEHQT----KTNIGHT 164

  Fly   204 EAPE-----------WKSVMKAETLEDIR-----RATNNDSRLVARMKELSDQFFEFLAAAPDRP 252
            ....           |.:...:..|..:|     :.....|.:..::..:.:..:|  .|||.: 
  Fly   165 YGDNLLEITVDSEIAWFTTGLSAVLAVVRSLAKYQGNREQSFIGDKLMGIMETIYE--QAAPSK- 226

  Fly   253 DGPFTSII-HCDFWINNIMFRYGPTGTPVELKIIDFQTAQYDSVVHDIISFLLSSVDTAILEVEF 316
              .:.::: |.|.|..||.|....:|..:   :|||||.:|.....|:...|..::.::..:...
  Fly   227 --KYRNVLCHRDIWAGNIFFPPENSGPAL---LIDFQTCRYAPPASDLNFCLYMNLSSSKRKQME 286

  Fly   317 EHMLEAYYEAFERCLRRVG------AKLE-VHTFKEFRL-----EVKRVAYIQVPHAIFMTRFIL 369
            :..::.|:....:.|..:|      :|.| :.:::||||     .......::||     |.||.
  Fly   287 KQGIDLYHTYLLQNLSDLGLEELVISKSELLESYEEFRLFGVVYRAVAATVVKVP-----TDFIT 346

  Fly   370 ADSALIGDSE 379
            .|...:..|:
  Fly   347 NDFKYVDRSK 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 62/326 (19%)
APH <214..329 CDD:279908 23/120 (19%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 54/283 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459636
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.