DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG33510

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:297 Identity:60/297 - (20%)
Similarity:118/297 - (39%) Gaps:36/297 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 VLVLENLRSSGYVS---GQRLKAFDLAHTLLA--LKYMAEFHALSLALRILRPEVFREQVRPFFK 197
            :.|::|:...|||:   |.|.    |....:.  ||.:|..||.|:|....:.:....:.|.:.|
  Fly   133 LFVMQNVEDMGYVALPPGTRF----LNENQMGPILKSLATLHASSIAYEKQQGKTIGVEFRKWLK 193

  Fly   198 KFDWHAEAPEW-----KSVMKAETLE-DIRRATNNDSRLVARMKELSDQFFEFLAAAPDRPDGPF 256
            :.....|. ||     ::|:....:. |:.........:...:....|:.:..:..:|...:   
  Fly   194 EVSVDPEV-EWYTTGLRAVLAVAAIHPDVLDNPEAQEYIAQELPRCLDKVYCMVNPSPVHRN--- 254

  Fly   257 TSIIHCDFWINNIMFRYGPTGTPVELK--IIDFQTAQYDSVVHD--IISFLLSSVDTAILEVEFE 317
             ..:|.|.|..|:.:.   ...|.|.:  ::|||..:|.....|  ::::|  :::....:....
  Fly   255 -VFVHRDAWNANVFYH---KEKPHEERSILVDFQLCRYSPPAMDFHLVTYL--NLEPFSRKKMIG 313

  Fly   318 HMLEAYYEAFERCLRRVGAK--LEVHTFKEFRLEVKRVAYIQVPH-AIFMTRFILADSALIGDSE 379
            .::|.||:|.....|.:|..  .|..:.:||...:...:.....: .|..|...|.|:.|  .:.
  Fly   314 SLIETYYDALAEEFREMGVNPYQEQLSKQEFEQSLNDFSLFGATYNCIAATVLRLPDNYL--KNL 376

  Fly   380 AEERPKLTDVLKNTGSERISRKLSQILNLAEKFDILY 416
            .:|||:  |..:....:|.:..|..:.|..|..|.:|
  Fly   377 KDERPE--DFHRFCNVDRSADVLRLMKNHPEFADYMY 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 41/211 (19%)
APH <214..329 CDD:279908 19/119 (16%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 40/208 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459637
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.