DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG33511

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:437 Identity:98/437 - (22%)
Similarity:172/437 - (39%) Gaps:126/437 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LLNYHTSSLTKPGDNYGSVLLAIHARLQKSN-------GESFEEQLVAKVPPIDPKYW-QFF--- 78
            |:...|.|:.|. ||    ::.|::::...:       ||.::..|.|:|.....||: .:|   
  Fly    11 LIAQRTLSVVKK-DN----VILINSQVDAGSKDLMGYMGEYYKLHLEAEVKGDKKKYFLNYFIKS 70

  Fly    79 -----QPE-QTC------LTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGCRESLESNSS 131
                 :|: :.|      ..|:|:|..:.|.:.....:         |.:|:.|..|        
  Fly    71 LPRKNEPQREECERKGVFQKESALYSQILPKIQKYATK---------KLYPKCYYSR-------- 118

  Fly   132 KVDQNAVLVLENLRSSGYVSGQRLKA---FDLAHTLLALKYMAEFHALSLALRILRPEVFREQVR 193
                |.:||||:| :..|   :.|:|   :.|.|..:.|::::|.||.|:|              
  Fly   119 ----NDILVLEDL-TQDY---RHLRANEYYTLDHYKIVLEHLSELHAASIA-------------- 161

  Fly   194 PFFKKFDWHAEAPEWKSVMKAETLEDIRRATNNDSR-------------LVAR------MKE--- 236
                   |.    |.::|...|:.:::....:.||.             |.||      ||.   
  Fly   162 -------WE----EKENVKIYESYKNVLIELHLDSNNSWYITGLKAIVFLAARNPHFQTMKAQNF 215

  Fly   237 LSDQFFEFLAAAPD--RPDGPFTSII-HCDFWINNIMFRYGPTGT--PVELKIIDFQTAQYDSVV 296
            :.|:.:..|..|.:  .|.....::: |.|.|.:||::.:....:  |....|:|||..||.|..
  Fly   216 IQDKLYNLLTKAEELVAPSKTIRNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPT 280

  Fly   297 HDIISFLLSSVDTA-ILEVEFEHMLEAYYEAFERCLRRVGAKLEVHTFKEFRLEVKRVAYIQVPH 360
            .|:: |||..|.:| :....::..||.||:..:..|.|:|....:.|...||.|.:|        
  Fly   281 LDVL-FLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITENNFRKECQR-------- 336

  Fly   361 AIFMTRFILADSALIGDSEAEERPKLTDVLKNTGSERISRKLSQILN 407
                ||.    :||:..:..|.:.|::..:.|........|....||
  Fly   337 ----TRL----AALVIWALTEPQTKMSPSISNRLRSEEPEKFDYYLN 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 78/352 (22%)
APH <214..329 CDD:279908 35/142 (25%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 75/328 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.