DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG31300

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster


Alignment Length:440 Identity:85/440 - (19%)
Similarity:158/440 - (35%) Gaps:111/440 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PEIRALSEVVEPHVSGSRLLNYHTSSLTKPGDNYGSVLLAIHARLQKSNGESFEEQLVAKVPPID 71
            ||::.:...:.|              .:..||:|.||:....|....:.|:.....::..:|..|
  Fly    37 PELKVVDLKITP--------------ASAQGDHYASVMFRTTAECTTAKGKFSRPLIIKAMPEQD 87

  Fly    72 PKYWQFFQPEQTCLTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGC-RESLESNSSKVDQ 135
            ..............||..:|..:.|....:..|:|  |:::.     |..| ..|||...     
  Fly    88 GHKKDMLSESHLFETEIGMYCQVLPEFERILRESG--DDTKL-----FVPCIYHSLEPRK----- 140

  Fly   136 NAVLVLENLRSSGY-------VSGQRLKAFDLAHTLLALKYMAEFHALSLALRILRPEVFREQVR 193
              |::.|:|...||       |:.:.||.        |...:|::||:|:       :..:|| .
  Fly   141 --VMIFEDLVPQGYYVIRDRPVAQEELKT--------AFAKLAKWHAISM-------KYIKEQ-P 187

  Fly   194 PFFKKFDWHA-EAPEWKS-----------VMKAETLEDIRRATNNDSRLVARMKELSDQFFEFLA 246
            .|.|:|.:.. |.|..|:           :...:.|.::|       :.....:::.|::.:.|.
  Fly   188 DFLKEFKYGLFEMPTVKTDPFITTGMQSFIEMLDRLPELR-------KYKPHFEKIKDKYMQRLQ 245

  Fly   247 AA-----PDRPDGPFTSIIHCDFWINNIMFRYGP-TGTPVELKIIDFQTAQYDSVVHDIISFLLS 305
            |.     .:|....|..:.|.||.:.|:||:... ||...:..::|||.:....:..|:...:..
  Fly   246 AVMKEYHENRKSDAFYVLCHGDFHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYM 310

  Fly   306 SVDTAILEVEFEHMLEAYYEAFERCLRRVG--------AKL--EVH-----------TFKEFRLE 349
            .::........:.::..|.......|:.:|        |||  |:|           ||....|.
  Fly   311 LMEPEQRREMGKDLINHYLTVLVATLKSIGYPGELPTQAKLWDEIHKNKYYDFFLLSTFLPLILA 375

  Fly   350 VKRVAY-----IQVPHAIFMTRFILADSALIGDSEAEERPKLTDVLKNTG 394
            :|..::     ||.|.....|.|:        |:..::..||....:..|
  Fly   376 IKSKSFKVNDLIQDPETRQKTYFL--------DTYVKDVSKLLPKFEQLG 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 63/324 (19%)
APH <214..329 CDD:279908 20/120 (17%)
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 63/325 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459644
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.