DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG31099

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster


Alignment Length:446 Identity:89/446 - (19%)
Similarity:163/446 - (36%) Gaps:142/446 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVDKLPE-IRALSEVVEPHVSGSRLLNYHTSSLTKPGDNYGSVLLAIHA--------------- 49
            |.|.|:|: :.:||            ||....|:.:.|....||:.::|.               
  Fly     1 MKVPKIPDWVSSLS------------LNQAVHSVLEDGVQITSVIPSVHLIQFRNCTVLLPIQVK 53

  Fly    50 -------------RLQKSNGESFEEQLVAKVPPIDPKYWQFFQPEQTCLTENAVYKILAPALATL 101
                         .|:..:|...:..::.::        :.||      .|:.||..:.|.|..:
  Fly    54 VQLRDFTMKKLFFLLKAQHGTDIQAMVMNQL--------KMFQ------REHQVYHNVLPKLEEI 104

  Fly   102 QDEAGVPDESQFKGFPRFYGCRESLESNSSKVDQN---AVLVLENLRSSGYVSGQRLKAFDLAHT 163
            ..|.|.               :.|....:.::|.:   ..::||:|::..|.:.:|...|:....
  Fly   105 YREVGK---------------KVSFGPRAFRLDYSIGVQYVLLEDLKAKSYKNVERQAGFNKLCL 154

  Fly   164 LLALKYMAEFHALSL------------------------ALRILR-PEVFREQVRPFFKKFDWHA 203
            ...||.:|:|||.|.                        .|:.|. ||:|..|:|          
  Fly   155 KQVLKKLAQFHAASAVCVEKHGAFSNLLVNGVYTKANESVLQELNDPEIFLSQLR---------- 209

  Fly   204 EAPEWKSVMKAETLEDIRRATNNDSRLVARMKELSDQFFEFLAAAPDRPDGPFTSIIHCDFWINN 268
               .|            |...:...|||.:.|:|.|...:.  .:||  ...|..:.|.|.|:||
  Fly   210 ---RW------------RLGDHFHKRLVEKEKDLVDGLLKL--HSPD--SNEFNVLNHSDCWVNN 255

  Fly   269 IMFRYGPTGTPVELKIIDFQTAQYDSVVHDIISFLLSSVDTAILEVEFEHMLEAY-YEAFE--RC 330
            :||::..:|...:..::|:|..:|.|...|:...:|||.:..|...:|::|::.| |...:  :.
  Fly   256 VMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLLDNLKA 320

  Fly   331 LRRVGAKLEVHTFKEFRLEVKRVAYIQVPHAI---FMTRFILADSALIGDSEAEER 383
            |...|:..::...::...:....||:.|..|:   .|.:|         :.|..||
  Fly   321 LNFGGSLPQLQHIRDALNKNGLAAYVVVTRALPITMMNQF---------EDEVNER 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 70/357 (20%)
APH <214..329 CDD:279908 31/117 (26%)
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 66/336 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459615
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.