DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG31436

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster


Alignment Length:382 Identity:77/382 - (20%)
Similarity:142/382 - (37%) Gaps:114/382 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RLLNYHTSSLTKPGDNYGSVLLAIHARLQKSNGESFEEQLVAKVPPIDPKYWQ-------FFQPE 81
            ::::...|..:..||:|.|::.....:.....|| |::.|:.|..|....:.:       .|:  
  Fly    40 KVIDLTFSPASAKGDHYASIMFRARVKYTNRKGE-FQKSLIIKTMPEAEGHKKDMLGGSPIFE-- 101

  Fly    82 QTCLTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGC-RESLESNSSKVDQNAVLVLENLR 145
                ||..:|..:.|....:..:.|  |::|.     :..| ..|||.:.       ||:.|:|.
  Fly   102 ----TEMGLYTKVLPEFERILRQVG--DDTQL-----YVNCIYHSLEPHQ-------VLIFEDLA 148

  Fly   146 SSGYVSGQRLKAFDLAHTLLALKY--MAEFHALSLALRILRPEVFREQVRPFF------------ 196
            ..||:.   |:..|.....:...|  :|::||:||.::..:||.........|            
  Fly   149 EMGYIV---LRDRDATLDEIRRIYFKLAKWHAVSLKVQNEQPEFLESYTHGLFEMPHVLNDPFMR 210

  Fly   197 -----------KKFDWHAEAPEWKSVMKAETLE-------DIRRATNNDSRLVARMKELSDQFFE 243
                       |:.:.:...|.::|: |.:.||       |||::...|...|            
  Fly   211 TGMEFFVELLGKEPELNKYKPYFESI-KDDFLERLVEEWKDIRKSQKKDEYWV------------ 262

  Fly   244 FLAAAPDRPDGPFTSIIHCDFWINNIMFRYGPTGTPVELKIIDFQTAQYDSVVHDIISFLLSSVD 308
                           :.|.|..:.||||::..|.:..:..::|||.:....:..|    ||.|: 
  Fly   263 ---------------LCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFD----LLYSI- 307

  Fly   309 TAILEVE-----FEHMLEAYYEAFERCLRRVGAK------------LEVHTFKEFRL 348
            ..:||.|     ::.::..|....:..|:::|.|            |..|.:.||.|
  Fly   308 YMLLEPEHRWNNWDDLINYYISVLQDVLKKIGYKGVMPSQSGLWKRLHQHKYYEFFL 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 69/343 (20%)
APH <214..329 CDD:279908 25/126 (20%)
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 69/344 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459648
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.