DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG31288

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster


Alignment Length:446 Identity:101/446 - (22%)
Similarity:176/446 - (39%) Gaps:98/446 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EP-HVSGSRLLNYHTSSLTKPGDNYGSVLLAIHARLQKSNGESFEEQLVAKVPPIDPKYWQFFQP 80
            || ||   ::|.:...:...||:|:.|.:|.::.:|:..:|                        
  Fly    33 EPDHV---KVLKFTVVAAIPPGENFTSTMLRVYIKLEMKDG------------------------ 70

  Fly    81 EQTCLTENAVYKILAPALATLQDEAGVPDESQFKGFPR-------FYGCRESLES---------- 128
              :..|:..::|.:.|      :|.|..|.::|..||:       :....|:|..          
  Fly    71 --SVKTKTYIFKTMLP------EERGGSDINEFGLFPKEAMMYKTYLPAFEALYKDVGWDIQLAP 127

  Fly   129 ---NSSKVDQNAVLVLENLRSSGYVSGQRLKAFDLAHTLLALKYMAEFHALSLALRILR---PEV 187
               ::.:.:.:...:.|:|....:.:..|.|..|:.|....|:.:||:||.|.....|.   |..
  Fly   128 KCLHTEEREGDIHFIFEDLCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHAASAVYEELHGPYPSE 192

  Fly   188 FREQ-VRPFFKKF---DWHAEAPEWKSVMKAETLEDIRRATNNDSRLVA--RMKELSDQFFEFLA 246
            |.|. |:...|||   .:..:...:|..|.:..|:|.      |..:.|  .:|:...|....|.
  Fly   193 FSEGFVKKDVKKFHVDGFQLKEKAYKKAMLSWGLKDA------DKYIKAFPTVKQYWAQCLSTLE 251

  Fly   247 AAPDRPDGPFTSIIHCDFWINNIMFRYGPTGTPVELKIIDFQTAQYDSVVHDIISFLLSSVDTAI 311
            ..||.    |..:.|.|||.:|:|..|.|.||..:|.:||||...:.|...|::.||..|....:
  Fly   252 LNPDE----FHVLNHGDFWSSNLMSSYLPDGTLEKLILIDFQIVMWGSPAMDLLFFLTLSPTNDL 312

  Fly   312 LEVEFEHMLEAYYEAFERCLRRVGAKLEVHTFKEFRLEVKR-----VAYIQV----PHAIFMTRF 367
            ...||:|.:..|:|....||:.:..|..:...::.:..:..     .|:..:    |..:|.|. 
  Fly   313 RIKEFDHFVRIYWERLVECLKVLKLKKPLPKLRDLQNSMNNKNHSFYAFFSILNHLPIILFPTD- 376

  Fly   368 ILADS---ALIGDSEAEERPKLTDVLKNTGSERISRKL------SQILNLAEKFDI 414
              .||   .|..::|..|..:|. :|.|.....:.:.|      ..|||. |.:|:
  Fly   377 --KDSNIHNLSANTEEGENYRLR-LLSNPAFGNVMKDLYPFLYNRGILNF-EDYDV 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 77/327 (24%)
APH <214..329 CDD:279908 35/116 (30%)
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 75/322 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459604
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.