DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG32195

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:360 Identity:83/360 - (23%)
Similarity:155/360 - (43%) Gaps:78/360 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RLLNYHTSSLTKPGDNYGSVLLAIHARLQKSNGESFEEQLVAKVPPIDPKY-WQFFQPEQTCL-- 85
            |:.|:|..::::.|:|:.||:..:....::|...:.|          ..|| .:...|....|  
  Fly    25 RVENFHIKAVSQKGENFCSVIYRVALVFRRSPDGALE----------SGKYILKDLLPAAAALGT 79

  Fly    86 TENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGCRESLESNSSKVDQNA---VLVLENLRSS 147
            .|..::::|.||:..:.:||           |:..| ...|.::...|:.:|   :.:||:|.:.
  Fly    80 NEKDMFEVLLPAMQAILEEA-----------PKEIG-EHKLSADCLLVEISAGKELYILEDLGAL 132

  Fly   148 GYVSGQRLKAFDLAHTLLALKYMAEFHALSLALRILRPEVFREQVRP---------------FFK 197
            ||.|..|.:..:|....:.::.:|:||..|..|...:||:. :::.|               ..:
  Fly   133 GYESFDRRQGLNLEEAKICVRKLAQFHGASKVLYEKKPELI-QRLSPSHYANGLNDRFAQALVLE 196

  Fly   198 KFDWHAEA-----PEWKSVMKAETLEDIRRATNNDSRLVARMKELSDQFFEFLAAAPDRPDGPFT 257
            ..::.|||     ||....|||:    |.:|      ...||:::.|         |::  ....
  Fly   197 GAEYAAEAFAEELPEISKKMKAQ----IPKA------YTKRMRDVVD---------PNK--SSLN 240

  Fly   258 SIIHCDFWINNIMFRYGPTGTPVELK--IIDFQTAQYDSVVHDIISFLLSSVDTAILEVEFEHML 320
            ::||.|.|:|||||.:      |..|  ::|||...:.|...|:.....:|:...:|....:.:|
  Fly   241 AVIHGDPWLNNIMFDF------VNKKATLVDFQNCYWGSPAIDLYFLFYTSLKPELLLNNQDELL 299

  Fly   321 EAYYEAFERCLRRVGAKLEVHTFKEFRLEVKRVAY 355
            ..|::.....||..|.|..:.||.:.:.|:||..:
  Fly   300 NYYFDNLLETLRHCGYKDTLPTFGQLKDEMKRCLF 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 73/326 (22%)
APH <214..329 CDD:279908 27/116 (23%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 73/327 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459341
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.