DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and CG33301

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster


Alignment Length:421 Identity:106/421 - (25%)
Similarity:183/421 - (43%) Gaps:41/421 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PEIRALSEVVEPHVSGSRL--LNYHTSSLTKPGDNYGSVLLAIHARLQKSNGE------SFEEQL 63
            |.:||       :....||  |.......|..|:|:..|:..|:...|..:|.      ..::.|
  Fly    13 PRLRA-------YCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYIVKQAL 70

  Fly    64 VAKVPPIDPKYWQFFQPEQTCLTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGCRESLES 128
            .|:||..:    .||:.| ....|..:|:.:.|.|..|..|||:.               :.|.:
  Fly    71 SAEVPQAE----VFFEYE-LYTREMDMYEFILPKLKELLQEAGLD---------------QKLTA 115

  Fly   129 NSSKVDQN-AVLVLENLRSSGYVSGQRLKAFDLAHTLLALKYMAEFHALSLALRILRPEVFREQV 192
            ::..||:. ..::||:|....:|:..|:|..|:|||.|.|:.:|:|||.|:.|:...|.:..:..
  Fly   116 DAITVDREYNTMILEDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERHPNLLTKCF 180

  Fly   193 RPFFKKFDWHAEAPEWKSVMKAETLEDIRRATNNDSRLVARMKELSDQFFEFLAAAPDRPDGPFT 257
            ...|...|..|.:..:..:.|| .|..|....|.......::.:|.....|:.|.|.|..:....
  Fly   181 YTHFFSRDKKAYSVVFAGLFKA-FLRFIDGQPNLKEAYGDKLHKLRTHIMEYGARAYDVGESDLK 244

  Fly   258 SIIHCDFWINNIMFRYGPTGTPVELKIIDFQTAQYDSVVHDIISFLLSSVDTAILEVEFEHMLEA 322
            ::.|.|.|..||||:|...|.|..:..||||.:...|...|:..|..:|:...:.:.|.| ::|.
  Fly   245 TLNHGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKESE-LVEH 308

  Fly   323 YYEAFERCLRRVGAKLEVHTFKEFRLEVKRVAYIQVPHAIFMTRFILADSALIGD--SEAEERPK 385
            :|:|.:..|.:...|..:.|.:|:||:.:|..::.:...:|....|...|....|  |...|.|:
  Fly   309 HYKALKANLEKFSYKGSLPTLQEYRLQFERRRFMSLLAHMFKPCMIYNGSEETSDFSSLYAESPE 373

  Fly   386 LTDVLKNT-GSERISRKLSQILNLAEKFDIL 415
            .....|:. .||.:.|..:::|.:.:...:|
  Fly   374 GLRYQKSVYASEAVIRSATKLLAILDAKGLL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 80/305 (26%)
APH <214..329 CDD:279908 32/114 (28%)
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 80/306 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459329
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.