DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and E02C12.12

DIOPT Version :10

Sequence 1:NP_722608.2 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_505432.2 Gene:E02C12.12 / 183991 WormBaseID:WBGene00017097 Length:200 Species:Caenorhabditis elegans


Alignment Length:184 Identity:40/184 - (21%)
Similarity:72/184 - (39%) Gaps:59/184 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LAIHARLQKSNGES-FEEQLVAKVPPI--DPKYWQFFQPEQTCLTENAVYKILAPALATLQDEAG 106
            ||:.:::.|..||: |.|:.:.::..:  |...           .|.|.||:|        ::..
 Worm    60 LAVLSKIMKLGGENGFSEEKLNELGKLIRDGHN-----------REVATYKLL--------EKMN 105

  Fly   107 VPDESQFKGFPRFYGCRESLESNSSKVDQNAVLVLE---NLRSSGYVSGQRLKAFD--LAHTLLA 166
            .||..    :.:.||.:...::|    |....:::|   |:||        :..::  ||..|::
 Worm   106 HPDIP----YTKVYGLKGYSDAN----DLKGFMIMEFIPNVRS--------IPMYEAILADDLIS 154

  Fly   167 L-KYMAEFHALSLALRILRPEVFREQVRPFFKKFDWHAEAPEWKSVMKAETLED 219
            | :.:|.|.||.        |...|:.:.|       |..||:...|..|...|
 Worm   155 LVRGIATFAALG--------ETLSEEEKAF-------AGGPEYLESMFEEVFTD 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_722608.2 Protein Kinases, catalytic domain 36..335 CDD:473864 40/184 (22%)
E02C12.12NP_505432.2 Protein Kinases, catalytic domain 1..>200 CDD:473864 40/184 (22%)

Return to query results.
Submit another query.