DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and C29F7.1

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:160 Identity:30/160 - (18%)
Similarity:57/160 - (35%) Gaps:44/160 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 EWKSVMKAETLED--------IRRATNNDSR-----LVAR------------MKELSDQFFEFLA 246
            ||:||:....:.|        ::....|.::     ::::            |.:.||::.|   
 Worm   184 EWRSVLPDSAMRDTVDLFEAMVKTIAENMAKSPGLEIISKYIEKTFDKDPSFMTKFSDEYLE--- 245

  Fly   247 AAPDRPDGPFTSII-HCDFWINNIMFRYGP--TGTPVELKIIDFQTAQYDSVVHDIISFLLSSVD 308
                   |...|:: |.|.|...|::....  .|      |||:|.....|.:.|:...|.:...
 Worm   246 -------GKRKSVLTHGDLWSPQILWDKDDNIAG------IIDWQVGHQGSPMEDLHRILSTGTS 297

  Fly   309 TAILEVEFEHMLEAYYEAFERCLRRVGAKL 338
            ........:.:|:.|:|.....|...|.|:
 Worm   298 VENRNKLTKPLLDHYFEKLSAGLEEKGVKM 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 28/155 (18%)
APH <214..329 CDD:279908 23/142 (16%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 28/153 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.