DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31975 and C29F7.2

DIOPT Version :9

Sequence 1:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_510235.2 Gene:C29F7.2 / 181463 WormBaseID:WBGene00007811 Length:394 Species:Caenorhabditis elegans


Alignment Length:346 Identity:60/346 - (17%)
Similarity:114/346 - (32%) Gaps:94/346 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 YWQFFQPEQTCLTENAVY-KILAPALATLQDEAGVPDESQFKGFPRFYGCRESLESNSSKVDQNA 137
            |::.|..    |||..:: .::..|:.....||.||                             
 Worm   110 YYKIFAK----LTEKPLHLPVIYAAIKAEDKEAPVP----------------------------- 141

  Fly   138 VLVLENLRS-------SGYVSGQRLKAFDLAHTLLALKYMAEFHALSLAL---RILRPEVFREQV 192
            |:|:|....       :|:...|..|..|         .:.:.|..||..   :.:.|:.|..::
 Worm   142 VIVMEMFEDCKVYDIITGFNEEQLYKIVD---------EIVKLHIFSLTTEEWKTIVPDAFVLEM 197

  Fly   193 RPFFKKF-----DWHAEAPEWKSVMKAETLEDIRRATNNDSRLVARMKELSDQFFEFLAAAPDRP 252
            ..:|:..     :..|:.|..:.|...     |:.....|.:.   ::.::|::.|         
 Worm   198 AGYFQTMVAGIGEKLAQQPGLELVSTY-----IKNTFATDPKF---LQNINDEYLE--------- 245

  Fly   253 DGPFTSIIHCDFWINNIMFRYGP--TGTPVELKIIDFQTAQYDSVVHDIISFLLSSVDTAILEVE 315
            :...:.:.|.|.|...|::....  .|      |||:|.....|.:.|....:.:.......:..
 Worm   246 ERRISVLTHGDLWAPQILWDKNDDIAG------IIDWQITHRGSPMEDFHHIMSTCTSVENRKNL 304

  Fly   316 FEHMLEAYYEAFERCLRRVGAKLEVHTFKEFRLEVKRVAYIQVPHAIFMTRF-----IL-----A 370
            .:.:|:.|::.....|...|.|:. .|.:|...|.|..........||...|     :|     .
 Worm   305 TKPLLDYYFDKLSSGLEAKGVKMP-WTREEIEEEYKYSFINGAALTIFANGFWANSPVLQTDGKP 368

  Fly   371 DSALIGDSEAEERPKLTDVLK 391
            |...||:|....:..|.:|::
 Worm   369 DPVRIGESFKRCKSYLEEVIQ 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 44/278 (16%)
APH <214..329 CDD:279908 17/116 (15%)
C29F7.2NP_510235.2 CHK 142..321 CDD:214734 33/210 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.