DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42797 and UBE3C

DIOPT Version :9

Sequence 1:NP_572574.2 Gene:CG42797 / 31905 FlyBaseID:FBgn0261931 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_055486.2 Gene:UBE3C / 9690 HGNCID:16803 Length:1083 Species:Homo sapiens


Alignment Length:501 Identity:150/501 - (29%)
Similarity:238/501 - (47%) Gaps:60/501 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   950 KVIAFLRQPNILEILRERQGQ-------HTMSRQLREKINILRVEGVPA------LERLGH--DL 999
            |||.     |::::|:.|..:       |.:|.|...|.:.:....|||      ..|:|.  .|
Human   603 KVIT-----NLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGRIGPL 662

  Fly  1000 QLTILLSLFEQEIMGFVPIEERSPQGSPVLNSRMPQRAPPPFRRDFEAKLRSFYR-----KLESK 1059
            |.|:.:.|             .||..|.....::......||...||.:::.|.|     |.|.:
Human   663 QSTLDVGL-------------ESPPLSVSEERQLAVLTELPFVVPFEERVKIFQRLIYADKQEVQ 714

  Fly  1060 GYGQGPHKLKLHIRRSHLLEDAFRRIMSANKKDLQRGRLAVLWDT----EEGLDYGGPSREFFFL 1120
            |.|.....:.:.|||:::.|||:.::...|:.||::.....|.:.    |.|:|.||..|||...
Human   715 GDGPFLDGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNE 779

  Fly  1121 LSRELFNPYYGLFEYSANDTYTVQVSPLSAFV--DNCHDWFRFSGRVLGLALVHQYLLDAFFTRP 1183
            |.:..|||..|.|: :.|:. .:..:|.:..:  |:....:.|.||:||.||....|::..|...
Human   780 LLKSGFNPNQGFFK-TTNEG-LLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFAGF 842

  Fly  1184 FYKALL--RLPVALSDLESLDNEFHQSLQWIR--DNDIGTGVDLGLTFCVTEELLGSVVDRELKP 1244
            |...||  ...|.:..|.|||.|.:::|.:::  ::|:   .:|||.|.|....||.....|||.
Human   843 FLSKLLGTSADVDIHHLASLDPEVYKNLLFLKSYEDDV---EELGLNFTVVNNDLGEAQVVELKF 904

  Fly  1245 GGKNIIINEKNKKEYLERMIKWRLERGVQEQTESLVRGFYEVIDSRLVSVFDARELELVIAGT-A 1308
            |||:|.:...|:..|:..:..:||.|.:::...:..:|...|:....:.:||.:|::::|:|. .
Human   905 GGKDIPVTSANRIAYIHLVADYRLNRQIRQHCLAFRQGLANVVSLEWLRMFDQQEIQVLISGAQV 969

  Fly  1309 EIDTNDWRLNTEYRSGYHDNHQVIVWFWQVIERFSNEQRLRLLQFVTGTSSIPYEGFSALRGSTG 1373
            .|...|.:..|.|..||..:|.||..||:|:|.|::|::.:||:|||..|..|..||..|..:  
Human   970 PISLEDLKSFTNYSGGYSADHPVIKVFWRVVEGFTDEEKRKLLKFVTSCSRPPLLGFKELYPA-- 1032

  Fly  1374 PRRFCIEKWGKP-NALPRAHTCFNRLDLPPYPTPELLYEKLLLAVE 1418
               |||...|.. ..||.|.||.|.|.||.:....||..|||.|:|
Human  1033 ---FCIHNGGSDLERLPTASTCMNLLKLPEFYDETLLRSKLLYAIE 1075

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42797NP_572574.2 WW 638..667 CDD:278809
HECTc 1068..1424 CDD:238033 118/363 (33%)
HECTc 1092..1423 CDD:214523 111/339 (33%)
UBE3CNP_055486.2 Cis-determinant of acceptor ubiquitin-binding 1..60
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
IQ 47..64 CDD:197470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..385
HECTc 725..1081 CDD:238033 118/361 (33%)
HECTc 747..1080 CDD:214523 111/339 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.