DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42797 and UBE3B

DIOPT Version :9

Sequence 1:NP_572574.2 Gene:CG42797 / 31905 FlyBaseID:FBgn0261931 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_569733.2 Gene:UBE3B / 89910 HGNCID:13478 Length:1068 Species:Homo sapiens


Alignment Length:393 Identity:126/393 - (32%)
Similarity:196/393 - (49%) Gaps:39/393 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1065 PHKLKLHIRRSHLLEDAFRRIMSANKKDLQRGRLAV-----LWDTEEGLDYGGPSREFFFLLSRE 1124
            ||...:.||||.:|||.:.::...::..: :|.:.|     |...|.|:|..|..:||...:.:.
Human   678 PHVTHITIRRSRMLEDGYEQLRQLSQHAM-KGVIRVKFVNDLGVDEAGIDQDGVFKEFLEEIIKR 741

  Fly  1125 LFNPYYGLFEYSANDTYTVQVSPLSAFVDNCHDWFRFSGRVLGLALVHQYLLDAFFTRPFYKALL 1189
            :|:|...||:.::.|. .:..||.|...:|....|.|.|::||.|:....::|..|...|...||
Human   742 VFDPALNLFKTTSGDE-RLYPSPTSYIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASFFLSQLL 805

  Fly  1190 R-----LPVALSDLESLDNEFHQSLQWIR--DNDIGTGVDLGLTFCVTEELLGSVVDRELKPGGK 1247
            .     ...::.:|.|||:||:::|..|:  |.||   .|||||....|:::|.:|..||.||||
Human   806 GHHHSVFYSSVDELPSLDSEFYKNLTSIKRYDGDI---TDLGLTLSYDEDVMGQLVCHELIPGGK 867

  Fly  1248 NIIINEKNKKEYLERMIKWRLERGVQEQTESLVRGFYEVIDSRLVSVFDARELELVIAG-TAEID 1311
            .|.:..:||..|:..|..:|:...::.||.:|:.||..:|....:.:|...||:.:|:| .||||
Human   868 TIPVTNENKISYIHLMAHFRMHTQIKNQTAALISGFRSIIKPEWIRMFSTPELQRLISGDNAEID 932

  Fly  1312 TNDWRLNTEYRSGYHDNHQVIVWFWQVI-ERFSNEQRLRLLQFVTGTSSIPYEGFSALR------ 1369
            ..|.:.:|.|..|:|.:|:||:|.|.:: ..|:.::|...|:|||..|..|..||:.|:      
Human   933 LEDLKKHTVYYGGFHGSHRVIIWLWDILASDFTPDERAMFLKFVTSCSRPPLLGFAYLKPPFSIR 997

  Fly  1370 --------------GSTGPRRFCIEKWGKPNALPRAHTCFNRLDLPPYPTPELLYEKLLLAVEET 1420
                          ||.....|.|.|......||.:.||||.|.||.|....:|.|||..|:...
Human   998 CVEVSDDQDTGDTLGSVLRGFFTIRKREPGGRLPTSSTCFNLLKLPNYSKKSVLREKLRYAISMN 1062

  Fly  1421 NTF 1423
            ..|
Human  1063 TGF 1065

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42797NP_572574.2 WW 638..667 CDD:278809
HECTc 1068..1424 CDD:238033 124/390 (32%)
HECTc 1092..1423 CDD:214523 116/364 (32%)
UBE3BNP_569733.2 HECTc 682..1066 CDD:238033 124/389 (32%)
HECTc 707..1065 CDD:214523 116/361 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.