DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42797 and UFD4

DIOPT Version :9

Sequence 1:NP_572574.2 Gene:CG42797 / 31905 FlyBaseID:FBgn0261931 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_012915.3 Gene:UFD4 / 853859 SGDID:S000001493 Length:1483 Species:Saccharomyces cerevisiae


Alignment Length:461 Identity:121/461 - (26%)
Similarity:193/461 - (41%) Gaps:88/461 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1023 PQGSPVLNSRMPQRAPPPFRRDFEAKLRSFYRKLESKGYG------QGPHKLKLHIRRSHLLED- 1080
            |..|..|..|.      ||...|:.  |..:.:..|.|||      :...|....:|....|:. 
Yeast  1039 PDWSLFLTRRF------PFLFPFDT--RMLFLQCTSFGYGRLIQLWKNKSKGSKDLRNDEALQQL 1095

  Fly  1081 --AFRRIMSANKKDLQRGRLAVL-------------WDTEEGLDYGGPSREFFFLLS----RELF 1126
              ..||.:..::|.:....|.:|             :..|.|... ||:.||:.::|    |:..
Yeast  1096 GRITRRKLRISRKTIFATGLKILSKYGSSPDVLEIEYQEEAGTGL-GPTLEFYSVVSKYFARKSL 1159

  Fly  1127 N-------PYYGLFEYSANDTYTVQV---SPLSAFVDN--CHDWFRFSGRVLGLALVHQYLLDAF 1179
            |       .|....:....|.|...:   .||:.|.:|  ..:.|.:.|..:..:|:...:||..
Yeast  1160 NMWRCNSYSYRSEMDVDTTDDYITTLLFPEPLNPFSNNEKVIELFGYLGTFVARSLLDNRILDFR 1224

  Fly  1180 FTRPFYKALLRL-----PVALSDLES-------LDNEFHQSLQWIRDN--DIGTGVDLGLTFCVT 1230
            |::.|::.|.|:     ....||:|:       :|....:||::|..|  |..|...|.|||.|.
Yeast  1225 FSKVFFELLHRMSTPNVTTVPSDVETCLLMIELVDPLLAKSLKYIVANKDDNMTLESLSLTFTVP 1289

  Fly  1231 EELLGSVVDRELKPGGKNIIINEKNKKEYLERMIKWRLERGVQEQTESLVRGFYEVID-SRLVSV 1294
            ..     .|.||.|||.|..:|..|.:||:..:|...|.:|:::|.::.:.||.:|.. .|::.:
Yeast  1290 GN-----DDIELIPGGCNKSLNSSNVEEYIHGVIDQILGKGIEKQLKAFIEGFSKVFSYERMLIL 1349

  Fly  1295 FDARELELV-IAGTAEIDTNDWRLNTEYRS-----GYHDNHQVIVWFWQVIERFSNEQRLRLLQF 1353
            |..   ||| |.|..|   .||.:.|.|.:     ||..:..:|..|..:|..|...:|...|||
Yeast  1350 FPD---ELVDIFGRVE---EDWSMATLYTNLNAEHGYTMDSSIIHDFISIISAFGKHERRLFLQF 1408

  Fly  1354 VTGTSSIPYEGFSALRGSTGPRRFCIEKWGKPNA-----LPRAHTCFNRLDLPPYPTPELLYEKL 1413
            :||:..:|..||.:|    .|:...:.|..:...     ||...||.|.|.||.|.:.:::..:|
Yeast  1409 LTGSPKLPIGGFKSL----NPKFTVVLKHAEDGLTADEYLPSVMTCANYLKLPKYTSKDIMRSRL 1469

  Fly  1414 LLAVEE 1419
            ..|:||
Yeast  1470 CQAIEE 1475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42797NP_572574.2 WW 638..667 CDD:278809
HECTc 1068..1424 CDD:238033 108/410 (26%)
HECTc 1092..1423 CDD:214523 103/383 (27%)
UFD4NP_012915.3 HUL4 581..1482 CDD:227354 121/461 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.