DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42797 and HECTD3

DIOPT Version :9

Sequence 1:NP_572574.2 Gene:CG42797 / 31905 FlyBaseID:FBgn0261931 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_078878.3 Gene:HECTD3 / 79654 HGNCID:26117 Length:861 Species:Homo sapiens


Alignment Length:350 Identity:90/350 - (25%)
Similarity:154/350 - (44%) Gaps:67/350 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1102 WDTE---EG-LDYGGPSREFFFLLSRELFNPYYGLFEYSANDTYTVQVSPLSAFV---------- 1152
            |:.:   || :|.||..|:....:|.||..        |:.||..    ||..||          
Human   528 WECKFIAEGIIDQGGGFRDSLADMSEELCP--------SSADTPV----PLPFFVRTANQGNGTG 580

  Fly  1153 ---------DNCHDWFRFS--GRVLGLALVHQYLLDAFFTRPFYKALLRLPVALS-DLESLDNEF 1205
                     .:|.|:.::.  |:::|.||..:..|........:|.|....|:.| |..::|:..
Human   581 EARDMYVPNPSCRDFAKYEWIGQLMGAALRGKEFLVLALPGFVWKQLSGEEVSWSKDFPAVDSVL 645

  Fly  1206 HQSLQWIRDNDIGT-----GVDLGLTFCVTEELLGSVVDRELKPGGKNIIINEKNKKEYLERMIK 1265
            .:.|:.:...|..|     |.:|..|..::::   .||  ||.|||..|::...::..:::.:.|
Human   646 VKLLEVMEGMDKETFEFKFGKELTFTTVLSDQ---QVV--ELIPGGAGIVVGYGDRSRFIQLVQK 705

  Fly  1266 WRLERGVQEQTESLVRGFYEVIDSRLVSVFDARELELVIAGTAEIDTNDWRLNTEYRSGYHDNHQ 1330
            .|||.. :||..::..|..:|:...::.:...:|||..:.|..|:..:..|..|.:.. :..:..
Human   706 ARLEES-KEQVAAMQAGLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFED-FEPSDS 768

  Fly  1331 VIVWFWQVIERFSNEQRLRLLQFVTGTSSIPYEGFSALRGSTGPRRFCI--EKWG--KPNALPRA 1391
            .:.:||:.:..|:||.|.|.|:||||.|.:             |.|..|  :|.|  ..:|||.:
Human   769 RVQYFWEALNNFTNEDRSRFLRFVTGRSRL-------------PARIYIYPDKLGYETTDALPES 820

  Fly  1392 HTCFNRLDLPPYPTPELLYEKLLLA 1416
            .||.:.|.||.|.:.::..|||..|
Human   821 STCSSTLFLPHYASAKVCEEKLRYA 845

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42797NP_572574.2 WW 638..667 CDD:278809
HECTc 1068..1424 CDD:238033 89/349 (26%)
HECTc 1092..1423 CDD:214523 89/349 (26%)
HECTD3NP_078878.3 APC10-HECTD3 238..371 CDD:176487
HECT 579..845 CDD:366212 72/285 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.