DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42797 and herc5.1

DIOPT Version :9

Sequence 1:NP_572574.2 Gene:CG42797 / 31905 FlyBaseID:FBgn0261931 Length:1426 Species:Drosophila melanogaster
Sequence 2:XP_017211386.1 Gene:herc5.1 / 559981 ZFINID:ZDB-GENE-090311-56 Length:884 Species:Danio rerio


Alignment Length:389 Identity:107/389 - (27%)
Similarity:174/389 - (44%) Gaps:38/389 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1044 DFEAKLRSFYRKLESKGYGQGPHKLKLHIRRSHLLEDAFRRIMSANKKDLQRGRLAVLWDTEEGL 1108
            :.|||. |:.|....||      :.:|.:||:.||||....:....::.|:...|::|:......
Zfish   522 NLEAKC-SYMRNRVWKG------RFELTVRRTALLEDCLCLLNPGTQQHLRDKWLSILFTENVSK 579

  Fly  1109 DYGGPSREFFFLLSRELFNPYYGLFEYSANDTYTVQVSPLSAFVDNCHDWFRFSGRVLGLALVHQ 1173
            ......|:||..:.:||.:|...||.|  ||..|:...|....|:. ..:|.| |.:.|||..:.
Zfish   580 RTDVHKRDFFLNVFKELCDPASQLFMY--NDNETMIWFPAKLTVEK-KKYFLF-GILCGLAFNNS 640

  Fly  1174 YLLDAFFTRPFYKALLRLPVALSDLESLDNEFHQSLQWIRD--NDIGTGVDLGLTFCVTEELLGS 1236
            .:::..|....:|.||.:..:|.|....:....:|||:|.:  ||:.....|.||      ::.|
Zfish   641 SVVNLPFPLALFKKLLNIKPSLEDFIEFNPVHGRSLQYILEYSNDVLEESSLPLT------IIWS 699

  Fly  1237 VVDRELKPGGKNIIINEKNKKEYLERMIKWRLERGVQEQTESLVRGFYEVIDSRLVSVFDARELE 1301
            ..:.:|.|......|...|:.::::..:.....:.|:|..|...|||:...:.|||.:|:..||.
Zfish   700 GSELDLDPAEPEQHITTSNRTKFVDEYVDHIFNQSVKEAFEEFRRGFFRGCEKRLVEMFEPEELR 764

  Fly  1302 LVIAGTAEIDTNDWRLNTEYRSGYHDNHQVIVWFWQVIERFSNEQRLRLLQFVTGTSSIPYEGFS 1366
            .|:.|..|.|.|..:.||.|...::.:|.||:.||:|.:..:..::...|.|:||...:|..|.|
Zfish   765 GVLVGNEEYDWNILKQNTTYEGVFNADHPVIISFWEVFDDLTPNEKKSFLLFLTGFERVPILGMS 829

  Fly  1367 A-------LRGSTGPRRFCIEKWGKPNALPRAHTCFNRLDLPPYPTPELLYEKLLLAVEETNTF 1423
            |       |..||            .:.||...||.:.|.||.|...|.|..|::.|:.....|
Zfish   830 AVKMRVTHLANST------------EDHLPETLTCHSLLQLPKYEKRETLRAKVIEAISHKRGF 881

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42797NP_572574.2 WW 638..667 CDD:278809
HECTc 1068..1424 CDD:238033 100/365 (27%)
HECTc 1092..1423 CDD:214523 92/339 (27%)
herc5.1XP_017211386.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.